PIC

User Tutorial

PIC

PIC

The OpenMS Developers

May 9, 2021 
Creative Commons Attribution 4.0 International  
(CC BY 4.0)

Contents

 1 General remarks
 2 Getting started
  2.1 Installation
  2.2 Data conversion
  2.3 Data visualization using TOPPView
  2.4 Introduction to KNIME / OpenMS
 3 Label-free quantification of peptides
  3.1 Introduction
  3.2 Peptide Identification
  3.3 Quantification
  3.4 Combining quantitative information across several label-free experiments
  3.5 Identification & Quantification of the iPRG2015 data with subsequent MSstats analysis
 4 Protein Inference
  4.1 Extending the LFQ workflow by protein inference and quantification
  4.2 Statistical validation of protein inference results
 5 Isobaric analysis
  5.1 Isobaric analysis workflow
  5.2 Excursion MSstatsTMT
  5.3 Dataset & Experimental Design
  5.4 Note
 6 Label-free quantification of metabolites
  6.1 Introduction
  6.2 Basics of non-targeted metabolomics data analysis
  6.3 Basic metabolite identification
  6.4 Downstream data analysis and reporting
 7 OpenSWATH
  7.1 Introduction
  7.2 Installation of OpenSWATH
  7.3 Installation of mProphet
  7.4 Generating the Assay Library
  7.5 OpenSWATH KNIME
  7.6 From the example dataset to real-life applications
 8 OpenSWATH for Metabolomics
  8.1 Introduction
  8.2 Workflow
  8.3 Prerequisites
  8.4 Benchmark data
  8.5 Example Workflow
  8.6 Run the Workflow
  8.7 Important parameters
 9 An introduction to pyOpenMS
  9.1 Introduction
  9.2 Installation
  9.3 Build instructions
  9.4 Scripting with pyOpenMS
  9.5 Tool development with pyOpenMS
 10 Quality control
  10.1 Introduction
  10.2 Building a qcML file per run
  10.3 Adding brand new QC metrics
  10.4 Set QC metrics
 11 Troubleshooting guide
  11.1 FAQ
  11.2 Sources of support

1 General remarks

2 Getting started

2.1 Installation

Before we get started we will install OpenMS and KNIME. If you take part in a training session you will have likely received an USB stick from us that contains the required data and software. If we provide laptops with the software you may of course skip the installation process and continue reading the next section.

2.1.1 Installation from the OpenMS USB stick

Please choose the directory that matches your operating system and execute the installer.

For example for Windows you call

on macOS you call

and follow the instructions. For the OpenMS installation on macOS, you need to accept the license drag and drop the OpenMS folder into your Applications folder.

Note: Due to increasing security measures for downloaded apps (e.g. path randomization) on macOS you might need to open TOPPView.app and TOPPAS.app while holding ctrl  and accept the warning. If the app still does not open, you might need to move them from Applications    OpenMS -2.6.0 to e.g. your Desktop and back.

On Linux you can extract KNIME to a folder of your choice and for TOPPView you need to install OpenMS via your package manager or build it on your own with the instructions under www.openms.de/documentation.

Note: If you have installed OpenMS on Linux or macOS via your package manager (for instance by installing the OpenMS-2.6.0-Linux.deb package), then you need to set the OPENMS_DATA_PATH variable to the directory containing the shared data (normally /usr/share/OpenMS). This must be done prior to running any TOPP tool.

2.1.2 Installation from the internet

If you are working through this tutorial at home you can get the installers under the following links:

Choose the installers for the platform you are working on.

2.2 Data conversion

Each MS instrument vendor has one or more formats for storing the acquired data. Converting these data into an open format (preferably mzML) is the very first step when you want to work with open-source mass spectrometry software. A freely available conversion tool is MSConvert, which is part of a ProteoWizard installation. All files used in this tutorial have already been converted to mzML by us, so you do not need to perform the data conversion yourself. However, we provide a small raw file so you can try the important step of raw data conversion for yourself.

Note: The OpenMS installation package for Windows automatically installs ProteoWizard, so you do not need to download and install it separately. Due to restrictions from the instrument vendors, file format conversion for most formats is only possible on Windows systems. In practice, performing the conversion to mzML on the acquisition PC connected to the instrument is usually the most convenient option.

To convert raw data to mzML using ProteoWizard you can either use MSConvertGUI (a graphical user interface) or msconvert (a simple command line tool). Both tools are available in:
C: Program   Files  OpenMS -2.6.0   share  OpenMS  THIRDPARTY   pwiz -bin . You can find a small RAW file on the USB stick C: Example  _Data  Introduction   datasets   raw
.

2.2.1 MSConvertGUI

MSConvertGUI (see Fig. 1) exposes the main parameters for data conversion in a convenient graphical user interface.

PIC

Figure 1: MSConvertGUI (part of ProteoWizard), allows converting raw files to mzML. Select the raw files you want to convert by clicking on the browse button and then on Add. Default parameters can usually be kept as-is. To reduce the initial data size, make sure that the peakPicking filter (converts profile data to centroided data (see Fig. 2)) is listed, enabled (true) and applied to all MS levels (parameter ”1-”). Start the conversion process by clicking on the Start button.

PIC

Figure 2: The amount of data in a spectra is reduced by peak picking. Here a profile spectrum (blue) is converted to centroided data (green). Most algorithms from this point on will work with centroided data.
2.2.2 msconvert

The msconvert command line tool has no user interface but offers more options than the application MSConvertGUI. Additionally, since it can be used within a batch script, it allows converting large numbers of files and can be much more easily automatized.

To convert and pick the file raw_data_file.RAW you may write:

msconvert raw_data_file.RAW --filter "peakPicking true 1-"

in your command line.

To convert all RAW files in a folder may write:

msconvert *.RAW  -o my _output_dir

Note: To display all options you may type msconvert --help  . Additional information is available on the ProteoWizard web page.

2.2.3 ThermoRawFileParser

Recently the open-source platform independent ThermoRawFileParser tool has been developed. While Proteowizard and MSConvert are only available for Windows systems this new tool allows to also convert raw data on Mac or Linux.

Note: To learn more about the ThermoRawFileParser and how to use it in KNIME see Section 2.4.7

2.3 Data visualization using TOPPView

Visualizing the data is the first step in quality control, an essential tool in understanding the data, and of course an essential step in pipeline development. OpenMS provides a convenient viewer for some of the data: TOPPView.

PIC

Figure 3: TOPPView, the graphical application for viewing mass spectra and analysis results. Top window shows a small region of a peak map. In this 2D representation of the measured spectra, signals of eluting peptides are colored according to the raw peak intensities. The lower window displays an extracted spectrum (=scan) from the peak map. On the right side, the list of spectra can be browsed.

We will guide you through some of the basic features of TOPPView. Please familiarize yourself with the key controls and visualization methods. We will make use of these later throughout the tutorial. Let’s start with a first look at one of the files of our tutorial data set. Note that conceptually, there are no differences in visualizing metabolomic or proteomic data. Here, we inspect a simple proteomic measurement:

PIC

Figure 4: 3D representation of the measured spectra, signals of eluting peptides are colored according to the raw peak intensities.

Dependent on your data MS/MS spectra can be visualized as well (see Fig.5) . You can do so, by double-click on the MS/MS spectrum shown in scan view.

PIC

Figure 5: MS/MS spectrum

2.4 Introduction to KNIME / OpenMS

Using OpenMS in combination with KNIME, you can create, edit, open, save, and run workflows that combine TOPP tools with the powerful data analysis capabilities of KNIME. Workflows can be created conveniently in a graphical user interface. The parameters of all involved tools can be edited within the application and are also saved as part of the workflow. Furthermore, KNIME interactively performs validity checks during the workflow editing process, in order to make it more difficult to create an invalid workflow.
Throughout most parts of this tutorial you will use KNIME to create and execute workflows. The first step is to make yourself familiar with KNIME. Additional information on basic usage of KNIME can be found on the KNIME Getting Started page. However, the most important concepts will also be reviewed in this tutorial.

2.4.1 Plugin and dependency installation

Before we can start with the tutorial we need to install all the required extensions for KNIME. Since KNIME 3.2.1 the program automatically detects missing plugins when you open a workflow but to make sure that the right source for the OpenMS plugin is chosen, please follow the instructions here. First, we install some additional extensions that are required by our OpenMS nodes or used in the Tutorials e.g. for visualization and file handling.

  1. Click on Help          Install New Software...
  2. From the Work with:
      drop-down list select http://update.knime.com/analytics- platform/4.2
  3. Now select the following plugins from the KNIME & Extensions category
  4. Click on Next
      and follow the instructions (you may but don’t need to restart KNIME now)
  5. Click again on Help          Install New Software...
  6. From the Work with:
      drop-down list select
    http://update.knime.com/community -contributions/trusted/4.2
  7. Now select the following plugin from the ”KNIME Community Contributions - Cheminformatics” category
  8. Click on Next
                                                                                       
                                                                                       
      and follow the instructions and after a restart of KNIME the dependencies will be installed.

In addition, we need to install R for the statistical downstream analysis. Choose the directory that matches your operating system, double-click the R installer and follow the instructions. We recommend to use the default settings whenever possible. On macOS you also need to install XQuartz from the same directory.

Afterwards open your R installation. If you use Windows, you will find an ”R x64 3.6.X” icon on your desktop. If you use macOS, you will find R in your Applications folder. In R type the following lines (you might also copy them from the file R install _R _packages.R folder on the USB stick):

   install.packages('Rserve',,"http://rforge.net/",type="source")   
  install.packages("Cairo")
 
  install.packages("devtools")  
  install.packages("ggplot2")  
  install.packages("ggfortify")
 
  if (!requireNamespace("BiocManager", quietly = TRUE))  
        install.packages("BiocManager")
 
  BiocManager::install() 
  BiocManager::install(c("MSstats"))

In KNIME, click on KNIME    Preferences  , select the category KNIMER  and set the ”Path to R Home” to your installation path. You can use the following settings, if you installed R as described above:

You are now ready to install the OpenMS nodes.

We included a custom KNIME update site to install the OpenMS KNIME plugins from the USB stick. If you do not have a stick available, please see below.

Alternatively, you can try these steps that will install the OpenMS KNIME plugins from the internet. Note that download can be slow.

https://abibuilder.informatik.uni- tuebingen.de/archive/openms/knime-plugin/updateSite/nightly/

2.4.2 KNIME concepts

A workflow is a sequence of computational steps applied to a single or multiple input data to process and analyze the data. In KNIME such workflows are implemented graphically by connecting so-called nodes. A node represents a single analysis step in a workflow. Nodes have input and output ports where the data enters the node or the results are provided for other nodes after processing, respectively. KNIME distinguishes between different port types, representing different types of data. The most common representation of data in KNIME are tables (similar to an excel sheet). Ports that accept tables are marked with a small triangle. For OpenMS nodes, we use a different port type, so called file ports, representing complete files. Those ports are marked by a small blue box. Filled blue boxes represent mandatory inputs and empty blue boxes optional inputs. The same holds for output ports, despite you can deactivate them in the configuration dialog (double-click on node) under the OutputTypes tab. After execution, deactivated ports will be marked with a red cross and downstream nodes will be inactive (not configurable).
A typical OpenMS workflow in KNIME can be divided in two conceptually different parts:

Moreover, nodes can have three different states, indicated by the small traffic light below the node.

If the node execution fails, the node will switch to the red state. Other anomalies and warnings like missing information or empty results will be presented with a yellow exclamation mark above the traffic light. Most nodes will be configured as soon as all input ports are connected. Some nodes need to know about the output of the predecessor and may stay red until the predecessor was executed. If nodes still remain in a red state, probably additional parameters have to be provided in the configuration dialog that can neither be guessed from the data nor filled with sensible defaults. In this case, or if you want to customize the default configuration in general, you can open the configuration dialog of a node with a double-click on the node. For all OpenMS nodes you will see a configuration dialog like the one shown in Figure 6.

Note: OpenMS distinguishes between normal parameters and advanced parameters. Advanced parameters are by default hidden from the users since they should only rarely be customized. In case you want to have a look at the parameters or need to customize them in one of the tutorials you can show them by clicking on the checkbox Show advanced parameter  in the lower part of the dialog. Afterwards the parameters are shown in a light gray color.

The dialog shows the individual parameters, their current value and type, and, in the lower part of the dialog, the documentation for the currently selected parameter. Please also note the tabs on the top of the configuration dialog. In the case of OpenMS nodes, there will be another tab called OutputTypes. It contains dropdown menus for every output port that let you select the output filetype that you want the node to return (if the tool supports it). For optional output ports you can select Inactive such that the port is crossed out after execution and the associated generation of the file and possible additional computations are not performed. Note that this will deactivate potential downstream nodes connected to this port.

PIC

Figure 6: Node configuration dialog of an OpenMS node.
2.4.3 Overview of the graphical user interface

PIC

Figure 7: The KNIME workbench.

The graphical user interface (GUI) of KNIME consists of different components or so-called panels that are shown in Figure 7. We will briefly introduce the individual panels and their purposes below.

Workflow Editor:
The workflow editor is the central part of the KNIME GUI. Here you assemble the workflow by adding nodes from the Node Repository via ”drag & drop”. For quick creation of a workflow, note that double-clicking on a node in the repository automatically connects it to the selected node in the workbench (connecting all the inputs with as many fitting outputs of the last node). Manually, nodes can be connected by clicking on the output port of one node and dragging the edge until releasing the mouse at the desired input port of the next node. Deletions are possible by selecting nodes and/or edges and pressing Del
      or (Fn
      +)Backspace
      depending on your OS and settings. Multiselection happens via dragging rectangles with the mouse or adding elements to the selection by clicking them while holding down Ctrl
      .
KNIME Explorer:
Shows a list of available workflows (also called workflow projects). You can open a workflow by double-clicking it. A new workflow can be created with a right-click in the Workflow Explorer followed by choosing New KNIME  Workflow...
      from the appearing context menu. Remember to save your workflow often with the Ctrl
      +S
      shortcut.
Workflow Coach (since KNIME 3.2.1):
Shows a list of suggested following nodes, based on the last added/clicked nodes. When you are not sure which node to choose next, you have a reasonable suggestion based on other users behavior there. Connect them to the last node with a double-click.
Node Repository:
Shows all nodes that are available in your KNIME installation. Every plugin you install will provide new nodes that can be found here. The OpenMS nodes can be found in Community NodeOspenMS
      . Nodes for managing files (e.g., Input Files or Output Folders) can be found in Community Nodes   GenericKnimeNodes
      . You can search the node repository by typing the node name into the small text box in the upper part of the node repository.
Outline:
The Outline panel contains a small overview of the complete workflow. While of limited use when working on a small workflow, this feature is very helpful as soon as the workflows get bigger. You can adjust the zoom level of the explorer by adjusting the percentage in the toolbar at the top of KNIME.
Console:
In the console panel warning and error messages are shown. This panel will provide helpful information if one of the nodes failed or shows a warning sign.
Node Description:
As soon as a node is selected, the Node Description window will show the documentation of the node including documentation for all its parameters and especially their in- and outputs, such that you know what types of data nodes may produce or expect. For OpenMS nodes you will also find a link to the tool page of the online documentation.
2.4.4 Creating workflows

Workflows can easily be created by a right click in the Workflow Explorer followed by clicking on New KNIME Work flow...
.

2.4.5 Sharing workflows

To be able to share a workflow with others, KNIME supports the import and export of complete workflows. To export a workflow, select it in the Workflow Explorer and select File           Export KNIME Workflow...  . KNIME will export workflows as a knwf file containing all the information on nodes, their connections, and their parameter configuration. Those knwf files can again be imported by selecting File            Import KNIME Workflow...
.

Note: For your convenience we added all workflows discussed in this tutorial to the Workflows folder on the USB Stick. Additionally, the workflow files can be found on our GitHub repository. If you want to check your own workflow by comparing it to the solution or got stuck, simply import the full workflow from the corresponding knwf file and after that double-click it in your KNIME Workflow repository to open it.

2.4.6 Duplicating workflows

In this tutorial, a lot of the workflows will be created based on the workflow from a previous task. To keep the intermediate workflows, we suggest you create copies of your workflows so you can see the progress. To create a copy of your workflow, save it, close it and follow the next steps.

2.4.7 A minimal workflow

Let us now start with the creation of our very first, very simple workflow. As a first step, we will gather some basic information about the data set before starting the actual development of a data analysis workflow. This minimal workflow can also be used to check if all requirements are met and that your system is compatible.

PIC

Figure 8: A minimal workflow calling FileInfo on a single file.

Workflows are typically constructed to process a large number of files automatically. As a simple example, consider you would like to convert multiple Thermo Raw files into the mzML format. We will now modify the workflow to compute the same information on three different files and then write the output files to a folder.

In case you had trouble to understand what ZipLoopStart and ZipLoopEnd do - here is a brief explanation:

PIC

Figure 9: A minimal workflow calling the FileConverter on multiple Thermo Raw files in a loop.
2.4.8 Digression: Working with chemical structures

Metabolomics analyses often involve working with chemical structures. Popular cheminformatic toolkits such as RDKit [7] or CDK [8] are available as KNIME plugins and allow us to work with chemical structures directly from within KNIME. In particular, we will use KNIME and RDKit to visualize a list of compounds and filter them by predefined substructures. Chemical structures are often represented as SMILES (Simplified molecular input line entry specification), a simple and compact way to describe complex chemical structures as text. For example, the chemical structure of L-alanine can be written as the SMILES string C[C@H](N)C(O)=O. As we will discuss later, all OpenMS tools that perform metabolite identification will report SMILES as part of their result, which can then be further processed and visualized using RDKit and KNIME.

PIC

Figure 10: Workflow to visualize a list of SMILES strings and filter them by predefined substructures.

Perform the following steps to build the workflow shown in in Fig. 10. You will use this workflow to visualize a list of SMILES strings and filter them by predefined substructures:

2.4.9 Advanced topic: Metanodes

Workflows can get rather complex and may contain dozens or even hundreds of nodes. KNIME provides a simple way to improve handling and clarity of large workflows:

Metanodes allow to bundle several nodes into a single Metanode.

Task

Select multiple nodes (e.g. all nodes of the ZipLoop including the start and end node). To select a set of nodes, draw a rectangle around them with the left mouse button or hold Ctrl  to add/remove single nodes from the selection. Pro-tip: There is a Select Loop  option when you right-click a node in a loop, that does exactly that for you. Then, open the context menu (right-click on a node in the selection) and select Create Metanode  . Enter a caption for the Metanode. The previously selected nodes are now contained in the Metanode. Double-clicking on the Metanode will display the contained nodes in a new tab window.

Task

Create the Metanode to let it behave like an encapsulated single node. First select the Metanode, open the context menu (right-click) and select Metanode Wrap  . The differences between Metanodes and their wrapped counterparts are marginal (and only apply when exposing user inputs and workflow variables). Therefore we suggest to use standard Metanodes to clean up your workflow and cluster common subparts until you actually notice their limits.

Task

Undo the packaging. First select the (Wrapped) Metanode, open the context menu (right-click) and select (Wrapped) MetanoEdxepand
.

2.4.10 Advanced topic: R integration

KNIME provides a large number of nodes for a wide range of statistical analysis, machine learning, data processing, and visualization. Still, more recent statistical analysis methods, specialized visualizations or cutting edge algorithms may not be covered in KNIME. In order to expand its capabilities beyond the readily available nodes, external scripting languages can be integrated. In this tutorial, we primarily use scripts of the powerful statistical computing language R. Note that this part is considered advanced and might be difficult to follow if you are not familiar with R. In this case you might skip this part.

R View (Table) allows to seamlessly include R scripts into KNIME. We will demonstrate on a minimal example how such a script is integrated.

Task

First we need some example data in KNIME, which we will generate using the Data Generator node. You can keep the default settings and execute the node. The table contains four columns, each containing random coordinates and one column containing a cluster number (Cluster_0 to Cluster_3). Now place a R View (Table) node into the workflow and connect the upper output port of the Data Generator node to the input of the R View (Table) node. Right-click and configure the node. If you get an error message like ”Execute failed: R_HOME does not contain a folder with name ’bin’.” or ”Execution failed: R Home is invalid.”: please change the R settings in the preferences. To do so open File     Preferences KNIMER  and enter the path to your R installation (the folder that contains the bin directory (e.g., C:  Program  Files   R R- 3.4.3
).

If you get an error message like: ”Execute failed: Could not find Rserve package. Please install it in your R installation by running
”install.packages(’Rserve’)”.” You may need to run your R binary as administrator (In windows explorer: right-click ”Run as administrator”) and enter install.packages(’Rserve’) to install the package.

If R is correctly recognized we can start writing an R script. Consider that we are interested in plotting the first and second coordinates and color them according to their cluster number. In R this can be done in a single line. In the R View (Table) text editor, enter the following code:

 plot(x=knime.in$Universe_0_0, y=knime.in$Universe_0_1, main="Plotting column Universe_0_0 vs. Universe_0_1", col=knime.in$"Cluster Membership")

Explanation: The table provided as input to the R View (Table) node is available as R data.frame with name knime.in. Columns (also listed on the left side of the R View window) can be accessed in the usual R way by first specifying the data.frame name and then the column name (e.g. knime.in$Universe_0_0). plot is the plotting function we use to generate the image. We tell it to use the data in column Universe_0_0 of the dataframe object knime.in (denoted as knime.in$Universe_0_0) as x-coordinate and the other column knime.in$Universe_0_1 as y-coordinate in the plot. main is simply the main title of the plot and col the column that is used to determine the color (in this case it is the Cluster Membership column).

Now press the Eval script  and Show plot  buttons.

Note: Note that we needed to put some extra quotes around Cluster Membership. If we omit those, R would interpret the column name only up to the first space (knime.in$Cluster) which is not present in the table and leads to an error. Quotes are regularly needed if column names contain spaces, tabs or other special characters like $ itself.

3 Label-free quantification of peptides

3.1 Introduction

In this chapter, we will build a workflow with OpenMS / KNIME to quantify a label-free experiment. Label-free quantification is a method aiming to compare the relative amounts of proteins or peptides in two or more samples. We will start from the minimal workflow of the last chapter and, step-by-step, build a label-free quantification workflow.

3.2 Peptide Identification

As a start, we will extend the minimal workflow so that it performs a peptide identification using the OMSSA [9] search engine. Since OpenMS version 1.10, OMSSA is included in the OpenMS installation, so you do not need to download and install it yourself.

In the next step, we will tweak the parameters of OMSSA to better reflect the instrument’s accuracy. Also, we will extend our pipeline with a false discovery rate (FDR) filter to retain only those identifications that will yield an FDR of < 1 %.

PIC

Figure 12: OMSSA ID pipeline including FDR filtering.
3.2.1 Bonus task: identification using several search engines

Note: If you are ahead of the tutorial or later on, you can further improve your FDR identification workflow by a so-called consensus identification using several search engines. Otherwise, just continue with section 3.3.

It has become widely accepted that the parallel usage of different search engines can increase peptide identification rates in shotgun proteomics experiments. The ConsensusID algorithm is based on the calculation of posterior error probabilities (PEP) and a combination of the normalized scores by considering missing peptide sequences.

In the end the ID processing part of the workflow can be collapsed into a Metanode to keep the structure clean (see Figure 13).

PIC

Figure 13: Complete consensus identification workflow.

3.3 Quantification

Now that we have successfully constructed a peptide identification pipeline, we can add quantification capabilities to our workflow.

PIC

Figure 15: Extended workflow featuring peptide identification and quantification.

3.4 Combining quantitative information across several label-free experiments

So far, we successfully performed peptide identification as well as quantification on individual LC-MS runs. For differential label-free analyses, however, we need to identify and quantify corresponding signals in different experiments and link them together to compare their intensities. Thus, we will now run our pipeline on all three available input files and extend it a bit further, so that it is able to find and link features across several runs.

PIC

Figure 16: Complete identification and label-free quantification workflow.
3.4.1 Basic data analysis in KNIME

For downstream analysis of the quantification results within the KNIME environment, you can use the ConsensusTextReader node in Community NodeOspenMS    Conversion  instead of the Output Folder node to convert the output into a KNIME table (indicated by a triangle as output port). After running the node you can view the KNIME table by right-clicking on the ConsensusTextReader and selecting Consensus Table  . Every row in this table corresponds to a so-called consensus feature, i.e., a peptide signal quantified across several runs. The first couple of columns describe the consensus feature as a whole (average RT and m/z across the maps, charge, etc.). The remaining columns describe the exact positions and intensities of the quantified features separately for all input samples (e.g., intensity_0 is the intensity of the feature in the first input file). The last 11 columns contain information on peptide identification.

PIC

Figure 17: Simple KNIME data analysis example for LFQ.

3.5 Identification & Quantification of the iPRG2015 data with subsequent MSstats analysis

Advanced downstream data analysis of quantitative mass spectrometry-based proteomics data can be performed using MSstats  [11]. This tool can be combined with an OpenMS preprocessing pipeline (e.g. in KNIME). The OpenMS experimental design is used to present the data in an MSstats-conformant way for the analysis. Here, we give an example how to utilize these resources when working with quantitative label-free data. We describe how to use OpenMS and MSstats for the analysis of the ABRF iPRG2015 dataset [12].

Note: Reanalysing the full dataset from scratch would take too long. In this tutorial session, we will focus on just the conversion process and the downstream analysis.

3.5.1 Excursion MSstats

The R package MSstats can be used for statistical relative quantification of proteins and peptides in mass spectrometry-based proteomics. Supported are label-free as well as labeled experiments in combination with data-dependent, targeted and data-independent acquisition. Inputs can be identified and quantified entities (peptides or proteins) and the output is a list of differentially abundant entities, or summaries of their relative abundance. It depends on accurate feature detection, identification and quantification which can be performed e.g. by an OpenMS workflow.

In general MSstats can be used for data processing & visualization, as well as statistical modeling & inference. Please see  [11] and http://msstats.org for further information.

3.5.2 Dataset

The iPRG (Proteome Informatics Research Group) dataset from the study in 2015, as described in  [12], aims at evaluating the effect of statistical analysis software on the accuracy of results on a proteomics label-free quantification experiment. The data is based on four artificial samples with known composition (background: 200 ng S. cerevisiae). These were spiked with different quantities of individual digested proteins, whose identifiers were masked for the competition as yeast proteins in the provided database (see Table 1).

Table 1: Samples (background: 200 ng S. cerevisiae) with spiked-in proteins in different quantities [fmols].
Samples
Name
Origin
Molecular Weight
1
2 3 4
A Ovalbumin Egg White 45 KD 65 55 15 2
B Myoglobin Equine Heart 17 KD 55 15 2 65
C Phosphorylase b Rabbit Muscle 97 KD 15 2 65 55
D Beta-Glactosidase Escherichia Coli 116 KD 2 65 55 15
E Bovine Serum Albumin Bovine Serum 66 KD 11 0.6 10 500
F Carbonic Anhydrase Bovine Erythrocytes 29 KD 10 500 11 0.6
3.5.3 Identification and Quantification

PIC

Figure 18: KNIME data analysis of iPRG LFQ data.

The iPRG LFQ workflow (Fig. 18) consists of an identification and a quantification part. The identification is achieved by searching the computationally calculated MS2 spectra from a sequence database (Input File node, here with the given database from iPRG: Example _Data  iPRG2015   database   iPRG2015 _target _decoy _nocontaminants.fasta) against the MS2 from the original data (Input Files node with all mzMLs following Example _Data  iPRG2015   datasets   JD_06232014  _sample*.mzML ) using the OMSSAAdapter.

Note: If you want to reproduce the results at home, you have to download the iPRG data in mzML format and perform Peakpicking on it. Or convert and pick the raw data with msconvert.

Afterwards the results are scored using the FalseDiscoveryRate node and filtered to obtain only unique peptides (IDFilter) since MSstats does not support shared peptides, yet. The quantification is achieved by the FeatureFinderCentroided, which performs the feature detection on the samples (maps). In the end the quantification results are combined with the filtered identification results (IDMapper). In addition, a linear retention time alignment is performed (MapAlignerPoseClustering), followed by the feature linking process (FeatureLinkerUnlabledQT). The ConsensusMapNormalizer is used to normalize the intensities via robust regression over a set of maps and the IDConflictResolver assures that only one identification (best score) is associated with a feature. The output of this workflow is a consensusXML file, which can now be converted using the MSstatsConverter (see section 3.5.5).

3.5.4 Experimental design

As mentioned before, the downstream analysis can be performed using MSstats. In this case an experimental design has to be specified for the OpenMS workflow. The structure of the experimental design used in OpenMS in case of the iPRG dataset is specified in Table 2. An explanation of the variables can be found in Table 3.

Table 2: OpenMS Experimental design for the iPRG2015 dataset.
Fraction_Group Fraction Spectra_Filepath Label Sample
1 1 Sample1-A 1 1
2 1 Sample1-B 1 2
3 1 Sample1-C 1 3
4 1 Sample2-A 1 4
5 1 Sample2-B 1 5
6 1 Sample2-C 1 6
7 1 Sample3-A 1 7
8 1 Sample3-B 1 8
9 1 Sample3-C 1 9
10 1 Sample4-A 1 10
11 1 Sample4-B 1 11
12 1 Sample4-C 1 12
Sample MSstats_Condition MSstats_BioReplicate
1 1 1
2 1 2
3 1 3
4 2 4
5 2 5
6 2 6
7 3 7
8 3 8
9 3 9
10 4 10
11 4 11
12 4 12

Table 3: Explanation of the column of the experimental design table
variables

value

Fraction_Group

Index used to group fractions and source files.

Fraction

1st, 2nd, .., fraction. Note: All runs must have the same number of fractions.

Spectra_Filepath

Path to mzML files

Label

label-free: always 1

TMT6Plex: 1...6

SILAC with light and heavy: 1..2

Sample

Index of sample measured in the specified label X, in fraction Y of fraction group Z.

Conditions

Further specification of different conditions (e.g. MSstats_Condition; MSstats_BioReplicate)

The conditions are highly dependent on the type of experiment and on which kind of analysis you want to perform. For the MSstats analysis the information which sample belongs to which condition and if there are biological replicates are mandatory. This can be specified in further condition columns as explained in Table 3. For a detailed description of the MSstats-specific terminology, see their documentation e.g. in the R vignette.

3.5.5 Conversion and downstream analysis

Conversion of the OpenMS-internal consensusXML format (which is an aggregation of quantified and possibly identified features across several MS-maps) to a table (in MSstats-conformant CSV format) is very easy. First, create a new KNIME workflow. Then, run the MSstatsConverter node with a consensusXML and the manually created (e.g. in Excel) experimental design as inputs (loaded via Input File nodes). The first input can be found in

Example _Data   iPRG2015  openmsLFQResults     iPRG_lfq.consensusXML

This file was generated by using the Workflows   openmsLFQ _iPRG2015.knwf workflow (seen in Fig. 18). The second input is specified in

Example _Data   iPRG2015  experimental   _design.tsv
.

Adjust the parameters in the config dialog of the converter to match the given experimental design file and to use a simple summing for peptides that elute in multiple features (with the same charge state, i.e. m/z value).

parameter value
msstats_bioreplicate MSstats_Bioreplicate
msstats_condition MSstats_Condition
labeled_reference_peptides false
retention_time_summarization_method (advanced) sum

The downstream analysis of the peptide ions with MSstats is performed in several steps. These steps are reflected by several KNIME R nodes, which consume the output of MSstatsConverter. The outline of the workflow is shown in Figure 19.

PIC

Figure 19: MSstats analysis using KNIME. The individual steps (Preprocessing, Group Comparisons, Result Data Renaming, and Export) are split among several consecutive nodes.

We load the file resulting from MSStatsConverter either by saving it with an Output File node and reloading it with the File Reader. Or for advanced users, you can use a URI Port to Variable node and use the variable in the File Reader config dialog (V button - located on the right of the ”Browse...” button) to read from the temporary file.

Preprocessing
The first node (Table to R) loads MSstats as well as the data from the previous KNIME node and performs a preprocessing step on the input data. The inline R script (that needs to be pasted into the config dialog of the node)

 library(MSstats)   
data <- knime.in 
quant <- OpenMStoMSstatsFormat(data, removeProtein_with1Feature = FALSE)

allows further preparation of the data produced by MSstatsConverter before the actual analysis is performed. In this example, the lines with proteins, which were identified with only one feature, were retained. Alternatively they could be removed.
In the same node, most importantly, the following line:

 processed.quant <- dataProcess(quant, censoredInt = 'NA')

transforms the data into a format that is understood by MSstats. Here, dataProcess is one of the most important functions that the R package provides. The function performs the following steps:

  1. Logarithm transformation of the intensities
  2. Normalization
  3. Feature selection
  4. Missing value imputation
  5. Run-level summarization

In this example, we just state that missing intensity values are represented by the ’NA’ string.

Group Comparison
The goal of the analysis is the determination of differentially-expressed proteins among the different conditions C1-C4. We can specify the comparisons that we want to make in a comparison matrix. For this, let’s consider the following example:

( − 1   1    0   0)
|                 |
| − 1   0    1   0|
|| − 1   0    0   1||
||                 ||
(  0   − 1   0   1)
   0    0   − 1  1
(3.1)

This matrix has the following properties:

We can generate such a matrix in R using the following code snippet in (for example) a new R to R node that takes over the R workspace from the previous node with all its variables:

         comparison1<-matrix(c(-1,1,0,0),nrow=1)   
        comparison2<-matrix(c(-1,0,1,0),nrow=1)
 
        comparison3<-matrix(c(-1,0,0,1),nrow=1)  
        comparison4<-matrix(c(0,-1,1,0),nrow=1)
 
        comparison5<-matrix(c(0,-1,0,1),nrow=1)  
        comparison6<-matrix(c(0,0,-1,1),nrow=1)
 
        comparison <- rbind(comparison1, comparison2, comparison3, comparison4, comparison5, comparison6) 
        row.names(comparison)<-c("C2-C1","C3-C1","C4-C1","C3-C2","C4-C2","C4-C3")

Here, we assemble each row in turn, concatenate them at the end, and provide row names for labeling the rows with the respective condition.

In MSstats, the group comparison is then performed with the following line:

         test.MSstats <- groupComparison(contrast.matrix=comparison, data=processed.quant)
 
}

No more parameters need to be set for performing the comparison.

Result Processing
In a next R to R node, the results are being processed. The following code snippet:

         test.MSstats.cr <- test.MSstats$ComparisonResult   

 
        # Rename spiked ins to A,B,C....  
        pnames <- c("A", "B", "C", "D", "E", "F")
 
        names(pnames) <- c(  
        "sp|P44015|VAC2_YEAST",  
        "sp|P55752|ISCB_YEAST",
 
        "sp|P44374|SFG2_YEAST",  
        "sp|P44983|UTR6_YEAST",  
        "sp|P44683|PGA4_YEAST",
 
        "sp|P55249|ZRT4_YEAST"  
        )  
          
        test.MSstats.cr.spikedins <- bind_rows(
 
        test.MSstats.cr[grep("P44015", test.MSstats.cr$Protein),],
 
        test.MSstats.cr[grep("P55752", test.MSstats.cr$Protein),],
 
        test.MSstats.cr[grep("P44374", test.MSstats.cr$Protein),],
 
        test.MSstats.cr[grep("P44683", test.MSstats.cr$Protein),],
 
        test.MSstats.cr[grep("P44983", test.MSstats.cr$Protein),],
 
        test.MSstats.cr[grep("P55249", test.MSstats.cr$Protein),]  
        )  
        # Rename Proteins
 
        test.MSstats.cr.spikedins$Protein <- sapply(test.MSstats.cr.spikedins$Protein, function(x) {pnames[as.character(x)]})
 
        test.MSstats.cr$Protein <- sapply(test.MSstats.cr$Protein, function(x) {
 
          
        x <- as.character(x)  
          
        if (x %in% names(pnames)) {
 
          
        return(pnames[as.character(x)])  
        } else {  
        return("")
 
        } 
        })

will rename the spiked-in proteins to A,B,C,D,E, and F and remove the names of other proteins, which will be beneficial for the subsequent visualization, as for example performed in Figure 20.

Export
The last four nodes, each connected and making use of the same workspace from the last node, will export the results to a textual representation and volcano plots for further inspection. Firstly, quality control can be performed with the following snippet:

         qcplot <- dataProcessPlots(processed.quant, type="QCplot",   
        ylimDown=0,
 
        which.Protein = 'allonly', 
        width=7, height=7, address=F)

The code for this snippet is embedded in the first output node of the workflow. The resulting boxplots show the log2 intensity distribution across the MS runs.

The second node is an R View (Workspace) node that returns a Volcano plot which displays differentially expressed proteins between conditions C2 vs. C1. The plot is described in more detail in the following Result section. This is how you generate it:

 groupComparisonPlots(data=test.MSstats.cr, type="VolcanoPlot",
 
                     width=12, height=12,dot.size = 2,ylimUp = 7,
 
                     which.Comparison = "C2-C1", 
                     address=F)

The last two nodes export the MSstats results as a KNIME table for potential further analysis or for writing it to a (e.g. csv) file. Note that you could also write output inside the Rscript if you are familiar with it. Use the following for an R to Table node exporting all results:

   knime.out <- test.MSstats.cr

And this for an R to Table node exporting only results for the spike-ins:

   knime.out <- test.MSstats.cr.spikedins
3.5.6 Result

An excerpt of the main result of the group comparison can be seen in Figure 20.

PIC PIC

Figure 20: Volcano plots produced by the Group Comparison in MSstats The dotted line indicates an adjusted p-value threshold

The Volcano plots show differently expressed spiked-in proteins. In the left plot, which shows the fold-change C2-C1, we can see the proteins D and F (sp|P44983|UTR6_YEAST and sp|P55249|ZRT4_YEAST) are significantly over-expressed in C2, while the proteins B,C, and E (sp|P55752|ISCB_YEAST, sp|P55752|ISCB_YEAST, and sp|P44683|PGA4_YEAST) are under-expressed. In the right plot, which shows the fold-change ratio of C3 vs. C2, we can see the proteins E and C (sp|P44683|PGA4_YEAST and sp|P44374|SFG2_YEAST) over-expressed and the proteins A and F (sp|P44015|VAC2_YEAST and sp|P55249|ZRT4_YEAST) under-expressed. The plots also show further differentially-expressed proteins, which do not belong to the spiked-in proteins.

The full analysis workflow can be found under
Workflows   MSstats _statPostProcessing   _iPRG2015.knwf
.

4 Protein Inference

In the last chapter, we have successfully quantified peptides in a label-free experiment. As a next step, we will further extend this label-free quantification workflow by protein inference and protein quantification capabilities. This workflow uses some of the more advanced concepts of KNIME, as well as a few more nodes containing R code. For these reasons, you will not have to build it yourself. Instead, we have already prepared and copied this workflow to the USB sticks. Just import Workflows  >  labelfree _with _protein  _quantification.knwf into KNIME via the menu entry File          Import KNIME workSfleolwect file  and double-click the imported workflow in order to open it.

Before you can execute the workflow, you again have to correct the locations of the files in the Input Files nodes (don’t forget the one for the FASTA database inside the “ID” meta node). Try and run your workflow by executing all nodes at once.

4.1 Extending the LFQ workflow by protein inference and quantification

We have made the following changes compared to the original label-free quantification workflow from the last chapter:

4.2 Statistical validation of protein inference results

In the following, we will explain the subworkflow contained in the Protein inference with FidoAdapter meta node.

4.2.1 Data preparation

For downstream analysis on the protein ID level in KNIME, it is again necessary to convert the idXML-file-format result generated from FidoAdapter into a KNIME table.

4.2.2 ROC curve of protein ID

ROC Curves (Receiver Operating Characteristic curves) are graphical plots that visualize sensitivity (true-positive rate) against fall-out (false positive rate). They are often used to judge the quality of a discrimination method like e.g., peptide or protein identification engines. ROC Curve already provides the functionality of drawing ROC curves for binary classification problems. When configuring this node, select the opt_global_target_decoy column as the class (i.e. target outcome) column. We want to find out, how good our inferred protein probability discriminates between them, therefore add
best_search_engine_score[1] (the inference engine score is treated like a peptide search engine score) to the list of ”Columns containing positive class probabilities”. View the plot by right-clicking and selecting View: ROC Curves  . A perfect classifier has an area under the curve (AUC) of 1.0 and its curve touches the upper left of the plot. However, in protein or peptide identification, the ground-truth (i.e., which target identifications are true, which are false) is usually not known. Instead, so called pseudo-ROC Curves are regularly used to plot the number of target proteins against the false discovery rate (FDR) or its protein-centric counterpart, the q-value. The FDR is approximated by using the target-decoy estimate in order to distinguish true IDs from false IDs by separating target IDs from decoy IDs.

4.2.3 Posterior probability and FDR of protein IDs

ROC curves illustrate the discriminative capability of the scores of IDs. In the case of protein identifications, Fido produces the posterior probability of each protein as the output score. However, a perfect score should not only be highly discriminative (distinguishing true from false IDs), it should also be “calibrated” (for probability indicating that all IDs with reported posterior probability scores of 95% should roughly have a 5% probability of being false. This implies that the estimated number of false positives can be computed as the sum of posterior error probabilities ( = 1 - posterior probability) in a set, divided by the number of proteins in the set. Thereby a posterior-probability-estimated FDR is computed which can be compared to the actual target-decoy FDR. We can plot calibration curves to help us visualize the quality of the score (when the score is interpreted as a probability as Fido does), by comparing how similar the target-decoy estimated FDR and the posterior probability estimated FDR are. Good results should show a close correspondence between these two measurements, although a non-correspondence does not necessarily indicate wrong results.

The calculation is done by using a simple R script in R snippet. First, the target decoy protein FDR is computed as the proportion of decoy proteins among all significant protein IDs. Then posterior probabilistic-driven FDR is estimated by the average of the posterior error probability of all significant protein IDs. Since FDR is the property for a group of protein IDs, we can also calculate a local property for each protein: the q-value of a certain protein ID is the minimum FDR of any groups of protein IDs that contain this protein ID. We plot the protein ID results versus two different kinds of FDR estimates in R View(Table) (see Fig. 22).

PIC

Figure 21: The workflow of statistical analysis of protein inference results

PIC

Figure 22: the pseudo-ROC Curve of protein IDs. The accumulated number of protein IDs is plotted on two kinds of scales: target-decoy protein FDR and Fido posterior probability estimated FDR. The largest value of posterior probability estimated FDR is already smaller than 0.04, this is because the posterior probability output from Fido is generally very high.

5 Isobaric analysis

In the last chapters, we identified and quantified peptides in a label-free experiment. In this section, we would like to introduce a possible workflow for the analysis of isobaric data.

5.1 Isobaric analysis workflow

Let’s have a look at the workflow (see Fig 23)

PIC

Figure 23: Workflow for the analysis of isobaric data

The full analysis workflow can be found here:
      Workflows

Identification  _quantification   _isobaric  _inference _epifany  _MSstatsTMT .

The workflow has four input nodes. The first for the experimental design to allow for MSstatsTMT compatible export (MSstatsConverter). The second for the .mzML files with the centroided spectra from the isobaric labeling experiment and the third one for the .fasta database used for identification. The last one allows to specify an output path for the plots generated by the R View, which runs MSstatsTMT (I). The quantification (A) is performed using the IsobaricAnalzyer. The tool is able to extract and normalize quantitative information from TMT and iTRAQ data. The values can be assessed from centroided MS2 or MS3 spectra (if available). Isotope correction is performed based on the specified correction matrix (as provided by the manufacturer). The identification (C) is applied as known from the previous chapters by using database search and a target-decoy database.

To reduce the complexity of the data for later inference the q-value estimation and FDR filtering is performed on PSM level for each file individually (B). Afterwards the identification (PSM) and quantiative information is combined using the IDMapper. After the processing of all available files, the intermediate results are aggregated (FileMerger - D). All PSM results are used for score estimation and protein inference (Epifany) (E). For detailed information about protein inference please see Chaper 4. Then, decoys are removed and the inference results are filtered via a protein group FDR. Peptide level results can be exported via MzTabExporter (F), protein level results can be obtained via the ProteinQuantifier (G) or the results can exported (MSstatsConverter - H) and further processed with the following R pipeline to allow for downstream processing using MSstatsTMT.

Please import the workflow from       Workflows  >

Identification  _quantification   _isobaric  _inference _epifany  _MSstatsTMT into KNIME via the menu entry File          Import KNIME workSfleolwect file  and double-click the imported workflow in order to open it. Before you can execute the workflow, you have to correct the locations of the files in the Input Files nodes (don’t forget the one for the FASTA database inside the “ID” meta node). Try and run your workflow by executing all nodes at once.

5.2 Excursion MSstatsTMT

The R package MSstatsTMT can be used for protein significance analysis in shotgun mass spectrometry-based proteomic experiments with tandem mass tag (TMT) labeling. MSstatsTMT provides functionality for two types of analysis & their visualization: Protein summarization based on peptide quantification and Model-based group comparison to detect significant changes in abundance. It depends on accurate feature detection, identification and quantification which can be performed e.g. by an OpenMS workflow.

In general MSstatsTMT can be used for data processing & visualization, as well as statistical modeling. Please see  [13] and http://msstats.org/msstatstmt/ for further information.

There is also a very helpful online lecture and tutorial for MSstatsTMT from the May Institute Workshop 2020. Please see https://youtu.be/3CDnrQxGLbA

5.3 Dataset & Experimental Design

We are using the MSV000084264 ground truth dataset, which consits of TMT10plex controlled mixes of different concentrated UPS1 peptides spiked into SILAC HeLa peptides measured in a dilution series https://www.omicsdi.org/dataset/massive/MSV000084264. Figure 24 shows the experimental design. In this experiment 5 different TMT10plex mixtures – different labeling strategies – were analysed. These were measured in triplicates represented by the 15 MS runs (3 runs each). The example data, database and experimental design to run the workflow can be found here https://abibuilder.informatik.uni-tuebingen.de/archive/openms/Tutorials/Data/isobaric_MSV000084264/.

PIC

Figure 24: Experimental Design

The experimental design in table format allows for MSstatsTMT compatible export. The design is represented by two tables. The first one 4 represents the overall structure of the experiment in terms of samples, fractions, labels and fraction groups. The second one 5 adds to the first by specifying specific conditions, biological replicates as well as mixtures and label for each channel. For additional information about the experimental design please see Table 3 in Chapter 3.5.4.

Table 4: Experimental Design 1
Spectra_Filepath Fraction Label Fraction_Group Sample
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 1 1 1
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 2 1 2
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 3 1 3
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 4 1 4
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 5 1 5
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 6 1 6
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 7 1 7
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 8 1 8
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 9 1 9
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_01.mzML 1 10 1 10
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 1 2 11
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 2 2 12
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 3 2 13
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 4 2 14
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 5 2 15
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 6 2 16
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 7 2 17
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 8 2 18
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 9 2 19
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_02.mzML 1 10 2 20
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 1 3 21
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 2 3 22
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 3 3 23
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 4 3 24
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 5 3 25
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 6 3 26
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 7 3 27
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 8 3 28
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 9 3 29
161117_SILAC_HeLa_UPS1_TMT10_SPS_MS3_Mixture1_03.mzML 1 10 3 30

Table 5: Experimental Design 2
Sample MSstats_Condition MSstats_BioReplicate MSstats_Mixture LabelName
1 Norm Norm 1 126
2 0.667 0.667 1 127N
3 0.125 0.125 1 127C
4 0.5 0.5 1 128N
5 1 1 1 128C
6 0.125 0.125 1 129N
7 0.5 0.5 1 129C
8 1 1 1 130N
9 0.667 0.667 1 130C
10 Norm Norm 1 131
11 Norm Norm 1 126
12 0.667 0.667 1 127N
13 0.125 0.125 1 127C
14 0.5 0.5 1 128N
15 1 1 1 128C
16 0.125 0.125 1 129N
17 0.5 0.5 1 129C
18 1 1 1 130N
19 0.667 0.667 1 130C
20 Norm Norm 1 131
21 Norm Norm 1 126
22 0.667 0.667 1 127N
23 0.125 0.125 1 127C
24 0.5 0.5 1 128N
25 1 1 1 128C
26 0.125 0.125 1 129N
27 0.5 0.5 1 129C
28 1 1 1 130N
29 0.667 0.667 1 130C
30 Norm Norm 1 131

After running the worklfow the MSstatsConverter will convert the OpenMS output in addition with the experimental design to a file (.csv) which can be processed by using MSstatsTMT.

5.3.1 MSstatsTMT analysis

Here, we depict the analysis by MSstatsTMT using a segment of the isobaric analysis workflow (Fig. 25 ). The segment is available as Workflows   MSstatsTMT.knwf .

Figure 25: MSstatsTMT workflow segment
PIC

There are two input nodes, the first one takes the result (.csv) from the MSstatsConverter and the second a path to the directory where the plots generated by MSstatsTMT should be saved. The R source node loads the required packages, such as dplyr for data wrangling, MSstatsTMT for analysis and MSstats for plotting. The inputs are further processed in the R View node.

Here, the data of the Input File is loaded into R using the flow variable [”URI-0”]:

 file <- substr(knime.flow.in[["URI-0"]], 6, nchar(knime.flow.in[["URI-0"]]))
 
MSstatsConverter_OpenMS_out <- read.csv(file) 
data <- MSstatsConverter_OpenMS_out

The OpenMStoMSstatsTMTFormat function preprocesses the OpenMS report and converts it into the required input format for MSstatsTMT, by filtering based on unique peptides and measurments in each MS run.

 processed.data <- OpenMStoMSstatsTMTFormat(data)

Afterwards different normalization steps are performed (global, protein, runs) as well as data imputation by using the msstats method. In addition peptide level data is summarized to protein level data.

 quant.data <- proteinSummarization(processed.data,   
                                   method="msstats",
 
                                   global_norm=TRUE,  
                                   reference_norm=TRUE,
 
                                   MBimpute = TRUE,  
                                   maxQuantileforCensored = NULL,
 
                                   remove_norm_channel = TRUE, 
                                   remove_empty_channel =  TRUE)

There a lot of different possibilities to configure this method please have a look at the MSstatsTMT package for additional detailed information http://bioconductor.org/packages/release/bioc/html/MSstatsTMT.html

The next step is the comparions of the different conditions, here either a pairwise comparision can be performed or a confusion matrix can be created. The goal is to detect and compare the UPS peptides spiked in at different concentrations.

 # prepare contrast matrix   
unique(quant.data$Condition)  
  
comparison<-matrix(c(-1,0,0,1,
 
                     0,-1,0,1,  
                     0,0,-1,1,
 
                     0,1,-1,0,  
                     1,-1,0,0), nrow=5, byrow = T)  

 
# Set the names of each row  
row.names(comparison)<- contrasts <- c("1-0125",
 
                                       "1-05",  
                                       "1-0667",
 
                                       "05-0667",  
                                       "0125-05")
 
# Set the column names 
colnames(comparison)<- c("0.125", "0.5", "0.667", "1")

The constructed confusion matrix is used in the groupComparisonTMT function to test for significant changes in protein abundance across conditions based on a family of linear mixed-effects models in TMT experiments.

 data.res <- groupComparisonTMT(data = quant.data,   
                               contrast.matrix = comparison,
 
                               moderated = TRUE, # do moderated t test
 
                               adj.method = "BH") # multiple comparison adjustment 
data.res <- data.res %>% filter(!is.na(Protein))

In the next step the comparison can be plotted using the groupComparisonPlots function by MSstats

 library(MSstats)  
groupComparisonPlots(data=data.res.mod, type="VolcanoPlot", address=F, which.Comparison = "0125-05", sig = 0.05)

Here, we have a example output of the R View, which depicts the significant regulated UPS proteins in the comparison of 125 to 05 (Fig. 26).

PIC

Figure 26: Volcanoplot of the group comparison regarding 0125 to 05.

All plots are saved to the in the beginning specified output directory in addition.

5.4 Note

The isobaric analysis does not always has to be performed on protein level, for example for phosphoproteomics studies one is usually interested on the peptide level - in addition inference on peptides with post-translational modification is not straight forward. Here, we present and additonal workflow on peptide level, which can potentially be adapted and used for such cases. Please see Workflows   Identification  _quantification   _isobaric _MSstatsTMT
.

6 Label-free quantification of metabolites

6.1 Introduction

Quantification and identification of chemical compounds are basic tasks in metabolomic studies. In this tutorial session we construct a UPLC-MS based, label-free quantification and identification workflow. Following quantification and identification we then perform statistical downstream analysis to detect quantification values that differ significantly between two conditions. This approach can, for example, be used to detect biomarkers. Here, we use two spike-in conditions of a dilution series (0.5 mg/l and 10.0 mg/l, male blood background, measured in triplicates) comprising seven isotopically labeled compounds. The goal of this tutorial is to detect and quantify these differential spike-in compounds against the complex background.

6.2 Basics of non-targeted metabolomics data analysis

For the metabolite quantification we choose an approach similar to the one used for peptides, but this time based on the OpenMS FeatureFinderMetabo method. This feature finder again collects peak picked data into individual mass traces. The reason why we need a different feature finder for metabolites lies in the step after trace detection: the aggregation of isotopic traces belonging to the same compound ion into the same feature. Compared to peptides with their averagine model, small molecules have very different isotopic distributions. To group small molecule mass traces correctly, an aggregation model tailored to small molecules is thus needed.

The parameters change the behavior of FeatureFinderMetabo as follows:

The output file .featureXML can be visualized with TOPPView on top of the used .mzML file - in a so called layer - to look at the identified features.

First start TOPPView and open the example .mzML file (see Fig. 28). Afterwards open the .featureXML output as new layer (see Fig. 29). The overlay is depicted in Figure 30. The zoom of the .mzML - .featureXML overlay shows the individual mass traces and the assembly of those in a feature (see Fig. 31).

PIC

Figure 28: Opened .mzML in TOPPView.

PIC

Figure 29: Add new layer in TOPPView.

PIC

Figure 30: Overlay of the .mzML layer with the .featureXML layer.

PIC

Figure 31: Zoom of the overlay of the .mzML with the .featureXML layer. Here the individual isotope traces (blue lines) are assembled into a feature here shown as convex hull (rectangular box).

The workflow can be extended for multi-file analysis, here an Input Files is to be used instead of the Input File. In front of the FeatureFinderMetabo a ZipLoopStart and behind ZipLoopEnd has to be used, since FeatureFinderMetabo will analyis on file to file bases.
To facilitate the collection of features corresponding to the same compound ion across different samples, an alignment of the samples’ feature maps along retention time is often helpful. In addition to local, small-scale elution differences, one can often see constant retention time shifts across large sections between samples. We can use linear transformations to correct for these large scale retention differences. This brings the majority of corresponding compound ions close to each other. Finding the correct corresponding ions is then faster and easier, as we don’t have to search as far around individual features.

PIC

Figure 32: Map alignment. The first feature map is used as a reference to which other maps are aligned. The calculated transformation brings corresponding features into close retention time proximity. Linking of these features form a so-called consensus features of a consensus map.

MapAlignerPoseClustering provides an algorithm to align the retention time scales of multiple input files, correcting shifts and distortions between them. Retention time adjustment may be necessary to correct for chromatography differences e.g. before data from multiple LC-MS runs can be combined (feature linking). The alignment algorithm implemented here is the pose clustering algorithm.

The parameters change the behavior of MapAlignerPoseClustering as follows:

The next step after retention time correction is the grouping of corresponding features in multiple samples. In contrast to the previous alignment, we assume no linear relations of features across samples. The used method is tolerant against local swaps in elution order.

PIC

Figure 33: Feature linking. Features A and B correspond to the same analyte. The linking of features between runs (indicated by an arrow) allows comparing feature intensities.

PIC

Figure 34: Label-free quantification workflow for metabolites

You should find a single, tab-separated file containing the information on where metabolites were found and with which intensities. You can also add Output Folder nodes at different stages of the workflow and inspect the intermediate results (e.g., identified metabolite features for each input map). The complete workflow can be seen in Figure 34. In the following section we will try to identify those metabolites.

The FeatureLinkerUnlabeledQT output can be visualized in ToppView on top of the input and output of the FeatureFinderMetabo (see Fig 35).

PIC

Figure 35: Visualization of .consensusXML output over the .mzML and .featureXML ’layer’.

6.3 Basic metabolite identification

At the current state we found several metabolites in the individual maps but so far don’t know what they are. To identify metabolites OpenMS provides multiple tools, including search by mass: the AccurateMassSearch node searches observed masses against the Human Metabolome Database (HMDB)[14, 15, 16]. We start with the workflow from the previous section (see Figure 34).

The result of the AccurateMassSearch node is in the mzTab format [17] so you can easily open it in a text editor or import it into Excel or KNIME, which we will do in the next section. The complete workflow from this section is shown in Figure 36.

PIC

Figure 36: Label-free quantification and identification workflow for metabolites
6.3.1 Convert your data into a KNIME table

The result from the TextExporter node as well as the result from the AccurateMassSearch node are files while standard KNIME nodes display and process only KNIME tables. To convert these files into KNIME tables we need two different nodes. For the AccurateMassSearch results we use the MzTabReader node (Community NodeOspenMS    ConversionmzTab  ) and its Small Molecule Section port. For the result of the TextExporter we use the ConsensusTextReader (Community NodeOspenMS    Conversion
).

When executed, both nodes will import the OpenMS files and provide access to the data as KNIME tables. The retention time values are exported as a list using the MzTabReader based on the current PSI-Standard. This has to be parsed using the SplitCollectionColumn, which outputs a ”Split Value 1” based on the first entry in the rention time list, which has to be renamed to retention time using the ColumnRename. You can now combine both tables using the Joiner node (ManipulationColumn      Split & Combine  ) and configure it to match the m/z and retention time values of the respective tables. The full workflow is shown in Figure 37.

PIC

Figure 37: Label-free quantification and identification workflow for metabolites that loads the results into KNIME and joins the tables.
6.3.2 Adduct grouping

Metabolites commonly co-elute as ions with different adducts (e.g., glutathione+H, glutathione+Na) or with charge-neutral modifications (e.g., water loss). Grouping such related ions allows to leverage information across features. For example, a low-intensity, single trace feature could still be assigned a charge and adduct due to a matching high-quality feature. Such information can then be used by several OpenMS tools, such as AccurateMassSearch, for example to narrow down candidates for identification.

For this grouping task, we provide the MetaboliteAdductDecharger node. Its method explores the combinatorial space of all adduct combinations in a charge range for optimal explanations. Using defined adduct probabilities, it assigns co-eluting features having suitable mass shifts and charges those adduct combinations which maximize overall ion probabilities.

The tool works natively with featureXML data, allowing the use of reported convex hulls. On such a single-sample level, co-elution settings can be chosen more stringently, as ionization-based adducts should not influence the elution time: Instead, elution differences of related ions should be due to slightly differently estimated times for their feature centroids.

Alternatively, consensusXML data from feature linking can be converted for use, though with less chromatographic information. Here, the elution time averaging for features linked across samples, motivates wider co-elution tolerances.

The two main tool outputs are a consensusXML file with compound groups of related input ions, and a featureXML containing the input file but annotated with inferred adduct information and charges.

Options to respect or replace ion charges or adducts allow for example:

PIC

Figure 38: Metabolite Adduct Decharger adduct grouping workflow

Task

A modified metabolomics workflow with exemplary MetaboliteAdductDecharger use and parameters is provided in
Workflows   Metabolite  _Adduct _Grouping.knwf . Run the workflow, inspect tool outputs and compare AccurateMassSearch results with and without adduct grouping.

6.3.3 Visualizing data

Now that you have your data in KNIME you should try to get a feeling for the capabilities of KNIME.

Task

Check out the Molecule Type Cast node (Chemistry   Translators  ) together with subsequent cheminformatics nodes (e.g. RDKit From Molecule (Community NodeRsDKit   Converters  )) to render the structural formula contained in the result table.

Task

Have a look at the Column Filter node to reduce the table to the interesting columns, e.g., only the Ids, chemical formula, and intensities.

Task

Try to compute and visualize the m/z and retention time error of the different feature elements (from the input maps) of each consensus feature. Hint: A nicely configured Math Formula (Multi Column) node should suffice.

6.3.4 Spectral library search

Identifying metabolites using only the accurate mass may lead to ambiguous results. In practice, additional information (e.g. the retention time) is used to further narrow down potential candidates. Apart from MS1-based features, tandem mass spectra (MS2) of metabolites provide additional information. In this part of the tutorial, we take a look on how metabolite spectra can be identified using a library of previously identified spectra.

Because these libraries tend to be large we don’t distribute them with OpenMS.

Task

Construct the workflow as shown in Fig. 39. Use the file  Example _Data   Metabolomics   datasets

Metabolite  _ID _SpectraDB _positive.mzML as input for your workflow. You can use the spectral library from
Example _Data   Metabolomics   databases   MetaboliteSpectralDB.mzML
as second input. The first input file contains tandem spectra that are identified by the MetaboliteSpectralMatcher. The resulting mzTab file is read back into a KNIME table The retention time values are exported as a list based on the current PSI-Standard. This has to be parsed using the SplitCollectionColumn, which outputs a ”Split Value 1” based on the first entry in the rention time list, which has to be renamed to retention time using the ColumnRename before it is stored in an Excel table. Make sure that you connect the MzTabReader port corresponding to the Small Molecule Section to the Excel writer (XLS). Please select the ”add column headers” option in the Excel writer (XLS)).

PIC

Figure 39: Spectral library identification workflow

Run the workflow and inspect the output.

6.3.5 Manual validation

In metabolomics, matches between tandem spectra and spectral libraries are manually validated. Several commercial and free online resources exist which help in that task. Some examples are:

Here, we will use METLIN to manually validate metabolites.

Task

Check in the .xlsx output from the Excel writer (XLS) if you can find glutathione. Use the retention time column to find the spectrum in the mzML file. Here open the file in the  Example _Data   Metabolomics   datasets
Metabolite  _ID _SpectraDB _positive.mzML in TOPPView. The MSMS spectrum with the retention time of 67.6 s is used as example. The spectrum can be selected based on the retention time in the scan view window. Therefore the MS1 spectrum with the retention time of 66.9 s has to be double clicked and the MSMS spectra recorded in this time frame will show up. Select the tandem spectrum of Glutathione, but do not close TOPPView, yet.

PIC

Figure 40: Tandem spectrum of glutathione. Visualized in TOPPView.

Task

On the METLIN homepage search for Name  Glutathione using the Advanced Search  (https://metlin.scripps.edu/landing_page.php?pgcontent=advanced_search). Note that free registration is required. Which collision energy (and polarity) gives the best (visual) match to your experimental spectrum in TOPPView? Here you can compare the fragmentation patterns in both spectra shown by the Intensity or relative Intensity, the m/z of a peak and the distance between peaks. Each distance between two peaks corresponds to a fragment of elemental composition (e.g., NH2 with the charge of one would have mass of two peaks of 16.023 Th).

PIC

Figure 41: Tandem spectrum of glutathione. Visualized in Metlin. Note that several fragment spectra from varying collision energies are available.
6.3.6 De novo identification

Another method for MS2 spectra-based metabolite identification is de novo identification. This approach can be used in addition to the other methods (accurate mass search, spectral library search) or individually if no spectral library is available. In this part of the tutorial, we discuss how metabolite spectra can be identified using de novo tools. To this end, the tools SIRIUS and CSI:FingerID ([18, 19, 20]) were integrated in the OpenMS Framework as SiriusAdapter. SIRIUS uses isotope pattern analysis to detect the molecular formula and further analyses the fragmentation pattern of a compound using fragmentation trees. CSI:FingerID is a method for searching a fingerprint of a small molecule (metabolite) in a molecular structure database.

The node is able to work in different modes depending on the provided input.

The last approach is the preferred one, as SIRIUS gains a lot of additional information by using the OpenMS tools for preprocessing.

Task

Construct the workflow as shown in Fig. 42.
Use the file  Example _Data   Metabolomics   datasets
Metabolite  _DeNovoID.mzML as input for your workflow.

PIC

Figure 42: De novo identification workflow

Run the workflow and inspect the output.

The output consists of two mzTab files and an internal .ms file. One mzTab for SIRIUS and the other for the CSI:FingerID. These provide information about the chemical formula, adduct and the possible compound structure. The information is referenced to the spectrum used in the analysis. Additional information can be extracted from the SiriusAdapter by setting an ”out_workspace_directory”. Here the SIRIUS workspace will be provided after the calculation has finished. This workspace contains information about annotated fragments for each successfully explained compound.

6.4 Downstream data analysis and reporting

In this part of the metabolomics session we take a look at more advanced downstream analysis and the use of the statistical programming language R. As laid out in the introduction we try to detect a set of spike-in compounds against a complex blood background. As there are many ways to perform this type of analysis we provide a complete workflow.

Task

Import the workflow from Workflows   metabolite  _ID.knwf in KNIME: File           Import KNIME Workflow...

The section below will guide you in your understanding of the different parts of the workflow. Once you understood the workflow you should play around and be creative. Maybe create a novel visualization in KNIME or R? Do some more elaborate statistical analysis? Note that some basic R knowledge is required to fully understand the processing in R Snippet nodes.

6.4.1 Signal processing and data preparation for identification

This part is analogous to what you did for the simple metabolomics pipeline.

6.4.2 Data preparation for quantification

The first part is identical to what you did for the simple metabolomics pipeline. Additionally, we convert zero intensities into NA values and remove all rows that contain at least one NA value from the analysis. We do this using a very simple R Snippet and subsequent Missing Value filter node.

Task

Inspect the R Snippet by double-clicking on it. The KNIME table that is passed to an R Snippet node is available in R as a data.frame named knime.in. The result of this node will be read from the data.frame knime.out after the script finishes. Try to understand and evaluate parts of the script (Eval Selection). In this dialog you can also print intermediary results using for example the R command head(knime.in) or cat(knime.in) to the Console pane.

6.4.3 Statistical analysis

After we linked features across all maps, we want to identify features that are significantly deregulated between the two conditions. We will first scale and normalize the data, then perform a t-test, and finally correct the obtained p-values for multiple testing using Benjamini-Hochberg. All of these steps will be carried out in individual R Snippet nodes.

6.4.4 Interactive visualization

KNIME supports multiple nodes for interactive visualization with interrelated output. The nodes used in this part of the workflow exemplify this concept. They further demonstrate how figures with data dependent customization can be easily realized using basic KNIME nodes. Several simple operations are concatenated in order to enable an interactive volcano plot.

Task

Inspect the nodes of this section. Customize your visualization and possibly try to visualize other aspects of your data.

6.4.5 Advanced visualization

R Dependencies: This section requires that the R packages ggplot2 and ggfortify are both installed. ggplot2 is part of the KNIME R Statistics Integration (Windows Binaries) which should already be installed via the full KNIME installer, ggfortify however is not. In case that you use an R installation where one or both of them are not yet installed, add an R Snippet node and double-click to configure. In the R Script text editor, enter the following code:

 #Include the next line if you also have to install ggplot2:   
install.packages("ggplot2")
 
#Include the following lines to install ggfortify:  
install.packages("ggfortify")
 
library(ggplot2) 
library(ggfortify)

You can remove the install.packages commands once it was successfully installed.

Even though the basic capabilities for (interactive) plots in KNIME are valuable for initial data exploration, professional looking depiction of analysis results often relies on dedicated plotting libraries. The statistics language R supports the addition of a large variety of packages, including packages providing extensive plotting capabilities. This part of the workflow shows how to use R nodes in KNIME to visualize more advanced figures. Specifically, we make use of different plotting packages to realize heatmaps.

6.4.6 Data preparation for Reporting

Following the identification, quantification and statistical analysis our data is merged and formatted for reporting. First we want to discard our normalized and logarithmized intensity values in favor of the original ones. To this end we first remove the intensity columns (Column Filter) and add the original intensities back (Joiner). For that we use an Inner Join 2 with the Joiner node. In the dialog of the node we add two entries for the Joining Columns and for the first column we pick ”retention_time” from the top input (i.e. the AccurateMassSearch output) and ”rt_cf” (the retention time of the consensus features) for the bottom input (the result from the quantification). For the second column you should choose ”exp_mass_to_charge” and ”mz_cf” respectively to make the joining unique. Note that the workflow needs to be executed up to the previous nodes for the possible selections of columns to appear.

PIC

Figure 43: Data preparation for reporting

Question

What happens if we use a Left Outer Join, Right Outer Join or Full Outer Join instead of the Inner Join?

Task

Inspect the output of the join operation after the Molecule Type Cast and RDKit molecular structure generation.

While all relevant information is now contained in our table the presentation could be improved. Currently, we have several rows corresponding to a single consensus feature (=linked feature) but with different, alternative identifications. It would be more convenient to have only one row for each consensus feature with all accurate mass identifications added as additional columns. To this end, we use the Column to Grid node that flattens several rows with the same consensus number into a single one. Note that we have to specify the maximum number of columns in the grid so we set this to a large value (e.g. 100). We finally export the data to an Excel file (XLS Writer).

7 OpenSWATH

7.1 Introduction

OpenSWATH [21] allows the analysis of LC-MS/MS DIA (data independent acquisition) data using the approach described by Gillet et al. [22]. The DIA approach described there uses 32 cycles to iterate through precursor ion windows from 400-426 Da to 1175-1201 Da and at each step acquires a complete, multiplexed fragment ion spectrum of all precursors present in that window. After 32 fragmentations (or 3.2 seconds), the cycle is restarted and the first window (400-426 Da) is fragmented again, thus delivering complete “snapshots” of all fragments of a specific window every 3.2 seconds.

The analysis approach described by Gillet et al. extracts ion traces of specific fragment ions from all MS2 spectra that have the same precursor isolation window, thus generating data that is very similar to SRM traces.

7.2 Installation of OpenSWATH

OpenSWATH has been fully integrated since OpenMS 1.10 [4, 2, 23, 24, 25]).

7.3 Installation of mProphet

mProphet (http://www.mprophet.org/) [26] is available as standalone script in External _Tools  mProphet . R (http://www.r-project.org/) and the package MASS (http://cran.r-project.org/web/packages/MASS/) are further required to execute mProphet. Please obtain a version for either Windows, Mac or Linux directly from CRAN.

PyProphet, a much faster reimplementation of the mProphet algorithm is available from PyPI (https://pypi.python.org/pypi/pyprophet/). The usage of pyprophet instead of mProphet is suggested for large-scale applications.

mProphet will be used in this tutorial.

7.4 Generating the Assay Library

7.4.1 Generating TraML from transition lists

OpenSWATH requires an assay library to be supplied in the TraML format [27]. To enable manual editing of transition lists, the TOPP tool TargetedFileConverter is available, which uses tab separated files as input. Example datasets are provided in Example _Data  OpenSWATH   assay . Please note that the transition lists need to be named .tsv.

The header of the transition list contains the following variables (with example values in brackets):

Required Columns:
PrecursorMz

The mass-to-charge (m/z) of the precursor ion. (924.539)
ProductMz

The mass-to-charge (m/z) of the product or fragment ion. (728.99)
LibraryIntensity

The relative intensity of the transition. (0.74)
NormalizedRetentionTime

The normalized retention time (or iRT) [28] of the peptide. (26.5)
Targeted Proteomics Columns:
ProteinId

A unique identifier for the protein. (AQUA4SWATH_HMLangeA)
PeptideSequence

The unmodified peptide sequence. (ADSTGTLVITDPTR)
ModifiedPeptideSequence

The peptide sequence with UniMod modifications. (ADSTGTLVITDPTR(UniMod:267))
PrecursorCharge

The precursor ion charge. (2)
ProductCharge

The product ion charge. (2)
Grouping Columns:
TransitionGroupId

A unique identifier for the transition group.
(AQUA4SWATH_HMLangeA_ADSTGTLVITDPTR(UniMod:267)/2)
TransitionId

A unique identifier for the transition.
(AQUA4SWATH_HMLangeA_ADSTGTLVITDPTR(UniMod:267)/2_y8)
Decoy

A binary value whether the transition is target or decoy. (target: 0, decoy: 1)
PeptideGroupLabel

Which label group the peptide belongs to.
DetectingTransition

Use transition for peak group detection. (1)
IdentifyingTransition

Use transition for peptidoform inference using IPF. (0)
QuantifyingTransition

Use transition to quantify peak group. (1)

For further instructions about generic transition list and assay library generation please see http://openswath.org/en/latest/docs/generic.html.

To convert transitions lists to TraML, use the TargetedFileConverter: Please use the absolute path to your OpenMS installation.

Linux or Mac

On the Terminal:

 TargetedFileConverter -in OpenSWATH_SGS_AssayLibrary_woDecoy.tsv -out OpenSWATH_SGS_AssayLibrary_woDecoy.TraML
Windows

On the TOPP command line:

 TargetedFileConverter.exe -in OpenSWATH_SGS_AssayLibrary_woDecoy.tsv -out OpenSWATH_SGS_AssayLibrary_woDecoy.TraML

7.4.2 Appending decoys to a TraML file

In addition to the target assays, OpenSWATH requires decoy assays in the library which are later used for classification and error rate estimation. For the decoy generation it is crucial that the decoys represent the targets in a realistic but unnatural manner without interfering with the targets. The methods for decoy generation implemented in OpenSWATH include ’shuffle’, ’pseudo-reverse’, ’reverse’ and ’shift’. To append decoys to a TraML, the TOPP tool OpenSwathDecoyGenerator can be used: Please use the absolute path to your OpenMS installation.

Linux or Mac

On the Terminal:

OpenSwathDecoyGenerator -in OpenSWATH_SGS_AssayLibrary_woDecoy.TraML -out OpenSWATH_SGS_AssayLibrary.TraML -method shuffle -switchKR false
Windows

On the TOPP command line:

  OpenSwathDecoyGenerator.exe -in OpenSWATH_SGS_AssayLibrary_woDecoy.TraML -out OpenSWATH_SGS_AssayLibrary.TraML -method shuffle -switchKR false

7.5 OpenSWATH KNIME

An example KNIME workflow for OpenSWATH is supplied in Workflows (Fig. 44). The example dataset can be used for this workflow (filenames in brackets):

  1. Open Workflows   OpenSWATH.knwf
      in KNIME: File            Import KNIME Work flow...
      .
  2. Select the normalized retention time (iRT) assay library in TraML format by double-clicking on node Input File     iRT Assay Library
      .
    (Example _Data  OpenSWATH   assay   OpenSWATH _iRT _AssayLibrary.TraML
      )
  3. Select the SWATH MS data in mzML format as input by double-clicking on node Input File     SWATH -MS files
      .
    (Example _Data  OpenSWATH   data  split _napedro  _L120420 _010 _SW- *.nf.pp.mzML
                                                                                       
                                                                                       
      )
  4. Select the target peptide assay library in TraML format as input by double-clicking on node Input Files  Assay Library
      .
    (Example _Data  OpenSWATH   assay   OpenSWATH _SGS _AssayLibrary.TraML
      )
  5. Set the output destination by double-clicking on node Output File
      .
  6. Run the workflow.

The resulting output can be found at your selected path, which will be used as input for mProphet. Execute the script on the Terminal (Linux or Mac) or cmd.exe (Windows) in Example _Data  OpenSWATH   result . Please use the absolute path to your R installation and the result file:

R --slave --args bin_dir=../../../External_Tools/mProphet/ mquest=OpenSWATH_quant.tsv workflow=LABEL_FREE num_xval=5 run_log=FALSE write_classifier=1 write_all_pg=1 < ../../../External_Tools/mProphet/mProphet.R

or for windows

"C:\Program Files\R\R-3.5.1\bin\x86\R.exe" --slave --args bin_dir=../../../External_Tools/mProphet/ mquest=OpenSWATH_quant.tsv workflow=LABEL_FREE num_xval=5 run_log=FALSE write_classifier=1 write_all_pg=1 < ../../../External_Tools/mProphet/mProphet.R

The main output will be called
OpenSWATH   result  mProphet _all _peakgroups.xls
with statistical information available in
OpenSWATH   result  mProphet.pdf
.

Please note that due to the semi-supervised machine learning approach of mProphet the results differ slightly when mProphet is executed several times.

PIC

Figure 44: OpenSWATH KNIME Workflow.

Additionally the chromatrogam output (.mzML) can be visualized for inspection with TOPPView.

For additional instructions on how to use pyProphet instead of mProphet please have a look at the PyProphet Legacy Workflow http://openswath.org/en/latest/docs/pyprophet_legacy.html. If you want to use the SQLite-based workflow in your lab in the future, please have a look here: http://openswath.org/en/latest/docs/pyprophet.html. The SQLite-based workflow will not be part of the tutorial.

7.6 From the example dataset to real-life applications

The sample dataset used in this tutorial is part of the larger SWATH MS Gold Standard (SGS) dataset which is described in the publication of Roest et al. [21]. It contains one of 90 SWATH-MS runs with significant data reduction (peak picking of the raw, profile data) to make file transfer and working with it easier. Usually SWATH-MS datasets are huge with several gigabyte per run. Especially when complex samples in combination with large assay libraries are analyzed, the TOPP tool based workflow requires a lot of computational resources. Additional information and instruction can be found at http://openswath.org/en/latest/.

8 OpenSWATH for Metabolomics

8.1 Introduction

We would like to present an automated DIA/SWATH analysis workflow for metabolomics, which takes advantage of experiment specific target-decoy assay library generation. This allows for targeted extraction, scoring and statistical validation of metabolomics DIA data [29], [30].

8.2 Workflow

The workflow follows multiple steps (see Fig. 45).

Candidate identification Feature detection, adduct grouping and accurate mass search are applied on DDA data.

Library construction The knowledge determined from the DDA data, about compound identification, its potential adduct and the corresponding fragment spectra are used to perform fragment annotation via compositional fragmentation trees [31]. Afterwards transitions, which are the reference of a precursor to its fragment ions are stored in a so-called assay library. Assay libraries usually contain additional metadata (i.e. retention time, peak intensities). FDR estimation is based on the target-decoy approach [32]. For the generation of the MS2 decoys, the fragmentation tree-based rerooting method ensures the consistency of decoy spectra [33]. Targeted extraction - The target-decoy assay library is then used to analyse SWATH data.

Targeted extraction Chromatogram extraction and peak-group scoring. This step is performed using an algorithm based on OpenSWATH [29] for metabolomics data.

Statistical validation FDR estimation uses the PyProphet algorithm [30]. To prevent overfitting we chose the simpler linear model (LDA) for target-decoy discrimination in PyProphet, using MS1 and MS2 scoring with low correlated scores.

PIC

Figure 45: DIAMetAlyzer - pipeline for assay library generation and targeted analysis with statistical validation. DDA data is used for candidate identification containing feature detection, adduct grouping and accurate mass search. Library construction uses fragment annotation via compositional fragmentation trees and decoy generation using a fragmentation tree re-rooting method to create a target-decoy assay library. This library is used in a second step to analyse metabolomics DIA data performing targeted extraction, scoring and statistical validation (FDR estimation).

8.3 Prerequisites

Apart from the usual KNIME nodes, the workflow uses python scripting nodes. One basic requirement for the installation of python packages, in particular pyOpenMS, is a package manager for python. Using conda as an environment manger allows to specify a specific environment in the KNIME settings (File     Preferences KNIME  Python
)

8.3.1 Windows

We suggest do use a virtual environment for the Python 3 installation on windows. Here you can install miniconda and follow the further instructions.

  1. Create new conda python environment

         conda create -n py37 python=3.7
  2. Activate py37 environment

         conda activate py37
  3. Install pip (see above)
  4. On the command line:

         python -m pip install -U pip   
        python -m pip install -U numpy  
        python -m pip install -U pandas
     
        python -m pip isntall -U pyprophet 
        python -m pip install -U pyopenms

8.3.2 MacOS

We suggest do use a virtual environment for the Python 3 installation on Mac. Here you can install miniconda and follow the further instructions.

  1. Create new conda python environment

         conda create -n py37 python=3.7
  2. Activate py37 environment

         conda activate py37
  3. On the Terminal:

         python -m pip install -U pip   
        python -m pip install -U numpy  
        python -m pip install -U pandas
     
        python -m pip isntall -U pyprophet 
        python -m pip install -U pyopenms

8.3.3 Linux

Use your package manager apt-get or yum, where possible.

  1. Install Python 3.7 (Debian: python-dev, RedHat: python-devel)
  2. Install NumPy (Debian / RedHat: python-numpy)
  3. Install setuptools (Debian / RedHat: python-setuptools)
  4. On the Terminal:

         python -m pip install -U pip   
        python -m pip install -U numpy  
        python -m pip install -U pandas
     
        python -m pip isntall -U pyprophet 
        python -m pip install -U pyopenms

8.4 Benchmark data

For the assay library construction pesticide mixes (Agilent Technologies, Waldbronn, Germany) were measured individually in solvent (DDA). Benchmark DIA samples were prepared by spiking different commercially available pesticide mixes into human plasma metabolite extracts in a 1:4 dilution series, which covers 5 orders of magnitude.

The example data can be found here: https://abibuilder.informatik.uni-tuebingen.de/archive/openms/Tutorials/Data/DIAMetAlyzer/

8.5 Example Workflow

Example workflow for the usage of the DIAMetAlyzer Pipeline in KNIME (see Fig. 46). Inputs are the SWATH-MS data in profile mode (.mzML), a path for saving the new target-decoy assay library, the SIRIUS 4.0.1 executable, the DDA data (.mzML), custom libraries and adducts for AccurateMassSearch, the min/max fragment mass-to-charge to be able to restrict the mass of the transitions and the path to the PyProphet executable. The DDA is used for feature detection, adduct grouping, accurate mass search and forwarded to the AssayGeneratorMetabo. The constructed target library is used by the decoy generation node, which calls various python scripts to parse, reformat the input, call Passatutto and export the target-decoy assay library. The target-decoy assay library is processed with the SWATH-MS data in OpenSWATH. The results are used by PyProphet for scoring and output a list of metabolites with their respective q-value and quantitative information.

PIC

Figure 46: Example workflow for the usage of the DIAMetAlyzer Pipeline in KNIME

8.6 Run the Workflow

These steps need to be followed to run the workflow successfully:

8.7 Important parameters

Please have a look at the most important parameters, which should be tweaked to fit your data. In general, OpenMS has a lot of room for parameter optimization to best fit your chromatography and instrumental settings.

FeatureFinderMetabo:

parameter

explanation



noise_threshold_int

Intensity threshold below which peaks are regarded as noise.

chrom_fwhm

Expected chromatographic peak width (in seconds).

mass_error_ppm

Allowed mass deviation (in ppm)

MetaboliteAdductDecharger:

parameter

explanation



mass_max_diff

Maximum allowed mass tolerance per feature..

potential_adducts

Adducts used to explain mass differences - These should fit to the adduct list specified for AccurateMassSearch.

AccurateMassSearch:

parameter

explanation



mass_error_value

Tolerance allowed for accurate mass search.

ionization_mode

Positive or negative ionization mode.

AssayGeneratorMetabo:

parameter

explanation



min_transitions

Minimal number of transitions (3).

max_transitions

Maximal number of transitions (3).

transitions_threshold

Further transitions need at least x% of the maximum intensity.

out_workspace_directory

Output directory for SIRIUS workspace (Fragmentation Trees).

filter_by_num_masstraces

Features have to have at least x MassTraces. To use this parameter feature_only is neccessary.

precursor_mass_tolerance

Tolerance window for precursor selection (Feature selection in regard to the precursor).

precursor_rt_tolerance

Tolerance allowed for matching MS2 spectra depeding on the feature size (should be around the FWHM of the chromatograms).

profile

Specify the used analysis profile (e.g. qtof).

elements

Allowed elements for assessing the putative sumformula (e.g. CHNOP[5]S[8]Cl[1]). Elements found in the isotopic pattern are added automatically, but can be specified nonetheless.

OpenSWATH:

parameter

explanation



rt_extraction_window

Extract x seconds around this value.

rt_normalization_factor

Please use the range of your gradient e.g. 950 seconds.

If you are analysing a lot of big DIA mzML files ≈ 3-20GB per File, it makes sense to change how OpenSWATH processes the spectra.

parameter

explanation



readOptions

Set cacheWorkingInMemory - will cache the files to disk and read SWATH-by-SWATH into memory

tempDirectory

Set a directory, where cached mzMLs are stored (be aware that his directory can be quite huge depending on the data).

In the workflow pyprophet is called after OpenSWATH, it merges the result files, which allows to get enough data for the model training.

 pyprophet merge  --template path_to_target-decoy_assay_library.pqp --out merged.osw  ./*.osw

Afterwards, the results are scored using the MS1 and MS2 levels and filter for metabolomics scores, which have a low correlation.

pyprophet score --in  merged.osw  --out  scored.osw --level ms1ms2 --ss_main_score "var_isotope_correlation_score" --ss_score_filter metabolomics

Export the non filtered results:

 pyprophet export-compound --in scored.osw --out scored + "_pyprophet_nofilter_ms1ms2.tsv"
 
--max_rs_peakgroup_qvalue 1000.0

Please see the workflow for actual parameter values used for the benchmarking dataset.

The workflow can be used without any identification (remove AccurateMassSearch). Here, all features (known_unknowns) are processed. The assay library is constructed based on the chemical composition elucidated via the fragment annotation. Quantification is possible, unfortunately the decoy generation and FDR estimation for this case is not yet available.

9 An introduction to pyOpenMS

9.1 Introduction

pyOpenMS provides Python bindings for a large part of the OpenMS library for mass spectrometry based proteomics and metabolomics. It thus provides access to a feature-rich, open-source algorithm library for mass-spectrometry based LC-MS analysis. These Python bindings allow raw access to the data-structures and algorithms implemented in OpenMS, specifically those for file access (mzXML, mzML, TraML, mzIdentML among others), basic signal processing (smoothing, filtering, de-isotoping and peak-picking) and complex data analysis (including label-free, SILAC, iTRAQ and SWATH analysis tools).

pyOpenMS is integrated into OpenMS starting from version 1.11. This tutorial is addressed to people already familiar with Python. If you are new to Python, we suggest to start with a Python tutorial (https://en.wikibooks.org/wiki/Non-Programmer%27s_Tutorial_for_Python_3).

9.2 Installation

One basic requirement for the installation of python packages, in particular pyOpenMS, is a package manager for python. We provide a package for pip (https://pypi.python.org/pypi/pip).

9.2.1 Windows

  1. Install Python 3.7 (http://www.python.org/download/)
  2. Install NumPy (http://www.lfd.uci.edu/~gohlke/pythonlibs/#numpy)
  3. Install pip (see above)
  4. On the command line:

         python -m pip install -U pip   
        python -m pip install -U numpy 
        python -m pip install pyopenms

9.2.2 MacOS

We suggest do use a virtual environment for the Python 3 installation on Mac. Here you can install miniconda and follow the further instructions.

  1. Create new conda python environment

         conda create -n py37 python=3.7 anaconda
  2. Activate py37 environment

         source activate py37
  3. On the Terminal:

         pip install -U pip   
        pip install -U numpy 
        pip install pyopenms

9.2.3 Linux

Use your package manager apt-get or yum, where possible.

  1. Install Python 3.7 (Debian: python-dev, RedHat: python-devel)
  2. Install NumPy (Debian / RedHat: python-numpy)
  3. Install setuptools (Debian / RedHat: python-setuptools)
  4. On the Terminal:

         pip install pyopenms

9.2.4 IDE with Anaconda integration

If you do not have python installed or do not want to modify your native installation, another possibility is to use an IDE (integrated development environment) with Anaconda integration. Here, we recommend spyder (https://www.spyder-ide.org/). It comes with Anaconda, which is a package and environment manager. Thus the IDE should be able to run a specific environment independent of your systems python installation.

Please execute the installer for your respective platform located in the respective directory for your platform and follow the installation instructions.

After installation the ANACONDA Navigator (Anaconda 3) should be available. Please start the application. To install pyopenms please choose the button ”Environments” and click the play symbol of the base environment and ”Open Terminal”.

Update pip and install pyopenms (MacOS, Linux):

 pip install -U pip   
pip install -U numpy 
pip install -U pyopenms

Update pip and install pyopenms (Windows):

 python -m pip install -U pip   
python -m pip install -U numpy 
python -m pip install -U pyopenms

Install a local available package:

 pip install numpy-1.15.4-cp37*.whl   
pip install pyopenms-2.4.0-cp37*.whl  
or (in case of windows)
 
python -m pip install -U numpy-1.15.4-cp37*.whl 
python -m pip install -U pyopenms-2.4.0-cp37*.whl

The local available packages can be found in the directory corresponding to your operating system. Please use the absolute path to the packages for the installation.

Now launch ”Spyder” (python IDE) in the home menu.

9.3 Build instructions

Instructions on how to build pyOpenMS can be found online (https://pyopenms.readthedocs.io/en/release_2.4.0/build_from_source.html).

9.4 Scripting with pyOpenMS

A big advantage of pyOpenMS are its scripting capabilities (beyond its application in tool development). Most of the OpenMS datastructure can be accessed using python (https://abibuilder.informatik.uni-tuebingen.de/archive/openms/Documentation/nightly/html/index.html). Here we would like to give some examples on how pyOpenMS can be used for simple scripting task, such as peptide mass calculation and peptide/protein digestion as well as isotope distribution calculation.

Calculation of the monoisotopic and average mass of a peptide sequence

 from pyopenms import *   
  
seq = AASequence.fromString("DFPIANGER")
 
  
mono_mass = seq.getMonoWeight(Residue.ResidueType.Full, 0)
 
average_mass = seq.getAverageWeight(Residue.ResidueType.Full, 0)  

 
print("The masses of the peptide sequence " + seq.toString().decode('utf-8') + " are:")
 
print("mono: " + str(mono_mass)) 
print("average: "+ str(average_mass))

Enzymatic digest of a peptide/protein sequence

 enzyme = "Trypsin"   
to_digest = AASequence.fromString("MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE")
 
after_digest = []  
  
EnzymaticDigest = EnzymaticDigestionLogModel()
 
EnzymaticDigest.setEnzyme(enzyme)  
EnzymaticDigest.digest(to_digest, after_digest)  

 
print("The peptide " + to_digest.toString().decode('utf-8') + " was digested using " + str(EnzymaticDigest.getEnzymeName().decode('utf-8')) + " to:")
 
  
for element in after_digest: 
    print(element.toString().decode('utf-8'))

Use empirical formula to calculate the isotope distribution

 from pyopenms import *   
  
methanol = EmpiricalFormula("CH3OH")  
water = EmpiricalFormula("H2O")
 
wm = EmpiricalFormula(water.toString().decode('utf-8') + methanol.toString().decode('utf-8'))
 
print(wm.toString().decode('utf-8'))  
print(wm.getElementalComposition())  

 
isotopes = wm.getIsotopeDistribution( CoarseIsotopePatternGenerator(3) )
 
for iso in isotopes.getContainer(): 
    print (iso.getMZ(), ":", iso.getIntensity())

For further examples and the pyOpenMS datastructure please see https://pyopenms.readthedocs.io/en/release_2.4.0/datastructures.html.

9.5 Tool development with pyOpenMS

Scripting is one side of pyOpenMS, the other is the ability to create Tools using the C++ OpenMS library in the background. In the following section we will create a ”ProteinDigestor” pyOpenMS Tool. It should be able to read in a fasta file. Digest the proteins with a specific enzyme (e.g. Trypsin) and export an idXML output file. Please see Example _Data  pyopenms for code snippets.

 usage: ProteinDigestor.py [-h] [-in INFILE] [-out OUTFILE] [-enzyme ENZYME]
 
                          [-min_length MIN_LENGTH] [-max_length MAX_LENGTH]
 
                          [-missed_cleavages MISSED_CLEAVAGES]  
  
ProteinDigestor −− In silico digestion of proteins.
 
  
optional arguments:  
  -h, --help            show this help message and exit
 
  -in INFILE            An input file containing amino acid sequences [fasta]
 
  -out OUTFILE          Output digested sequences in idXML format [idXML]
 
  -enzyme ENZYME        Enzyme used for digestion  
  -min_length MIN_LENGTH                Minimum length of peptide
 
  -max_length MAX_LENGTH                Maximum length of peptide 
  -missed_cleavages MISSED_CLEAVAGES                        The number of allowed missed cleavages
9.5.1 Basics

First, your tool needs to be able to read parameters from the command line and provide a main routine. Here standard Python can be used (no pyOpenMS is required so far).

 #!/usr/bin/env python   
import sys  
  
def main(options):  
  
    # test parameter handling
 
    print(options.infile, options.outfile, options.enzyme, options.min_length, options.max_length, options.missed_cleavages)
 
  
def handle_args():  
    import argparse  
  
    usage = ""
 
    usage += "\nProteinDigestor −− In silico digestion of proteins."
 
  
    parser = argparse.ArgumentParser(description = usage)
 
    parser.add_argument('-in', dest='infile', help='An input file containing amino acid sequences [fasta]')
 
    parser.add_argument('-out', dest='outfile', help='Output digested sequences in idXML format [idXML]')
 
    parser.add_argument('-enzyme', dest='enzyme', help='Enzyme used for digestion')
 
    parser.add_argument('-min_length', type=int, dest='min_length', help ='Minimum length of peptide')
 
    parser.add_argument('-max_length', type=int, dest='max_length', help='Maximum length of peptide')
 
    parser.add_argument('-missed_cleavages', type=int, dest='missed_cleavages', help='The number of allowed missed cleavages')
 
  
    args = parser.parse_args(sys.argv[1:])  
    return args  
  
if __name__ == '__main__':
 
    options = handle_args() 
    main(options)

Open the Anaconda Terminal and change into the Example _Data  pyopenms directory. Execute the example script.

 python ProteinDigestor_argparse.py -h

python ProteinDigestor_argparse.py -in mini_example.fasta -out mini_example_out.idXML -enzyme Trypsin -min_length 6 -max_length 40 -missed_cleavages 1

The parameters are being read from the command line by the function handle_args() and given to the main() function of the script, which prints the different variables.

OpenMS has a ProteaseDB class containing a list of enzymes which can be used for digestion of proteins. You can add this to the argparse code to be able to see the usable enzymes. From this point onward pyOpenMS is required.

     # from here pyopenms is needed   
    # get available enzymes from ProteaseDB
 
    all_enzymes = []  
    p_db=ProteaseDB().getAllNames(all_enzymes)  

 
    # concatenate them to the enzyme argument. 
    parser.add_argument('-enzyme', dest='enzyme', help='Enzymes which can be used for digestion: '+ ', '.join(map(bytes.decode, all_enzymes)))
9.5.2 Loading data structures with pyOpenMS

We already scripted enzymatic digestion with the AASequence and EnzymaticDigest (see above). To make this even easier, we can use an existing class in OpenMS, called ProteaseDigestion.

     # Use the ProteaseDigestion class   
    # set the enzyme used for digestion and the number of missed cleavages
 
    digestor = ProteaseDigestion()  
    digestor.setEnzyme(options.enzyme)
 
    digestor.setMissedCleavages(options.missed_cleavages)  
  
    # call the ProteaseDigestion::digest function
 
    # which will return the number of discarded digestions products
 
    # and fill the current_digest list with digestes peptide sequences 
    digestor.digest(aaseq.fromString(fe.sequence), current_digest, options.min_length, options.max_length)

The next step is to use FASTAFile class to read the fasta input:

     # construct a FASTAFile Object and read the input file   
    ff = FASTAFile()
 
    ff.readStart(options.infile)  
  
    # construct and FASTAEntry Object  
    fe = FASTAEntry()
 
  
    # loop over the entry in the fasta while using while 
    while(ff.readNext(fe)):

The output idXML needs the information about protein and peptide level, which can be saved in the ProteinIdentification and PeptideIdentification classes.

     idxml = IdXMLFile()  
    idxml.store(options.outfile, protein_identifications, peptide_identifications)

This is the part of the program which unifies the snippets provided above. Please have a closer look how the protein and peptide datastructure is incorporated in the program.

 def main(options):   
    # read fasta file  
    ff = FASTAFile()  
    ff.readStart(options.infile)
 
    fe = FASTAEntry()  
  
    # use ProteaseDigestion class  
    digestor = ProteaseDigestion()
 
    digestor.setEnzyme(options.enzyme)  
    digestor.setMissedCleavages(options.missed_cleavages)  

 
    # protein and peptide datastructure  
    protein_identifications = []
 
    peptide_identifications = []  
    protein_identification = ProteinIdentification()
 
    protein_identifications.append(protein_identification)  
    temp_pe = PeptideEvidence()  

 
    # number of dropped peptides due to length restriction  
    dropped_by_length = 0  
  
    while(ff.readNext(fe)):
 
        # construct ProteinHit and fill it with sequence information  
        temp_protein_hit = ProteinHit()
 
        temp_protein_hit.setSequence(fe.sequence)  
        temp_protein_hit.setAccession(fe.identifier)
 
  
        # save the ProteinHit in a ProteinIdentification Object
 
        protein_identification.insertHit(temp_protein_hit)  

 
        # construct a PeptideHit and save the ProteinEvidence (Mapping) for the specific  
        # current protein
 
        temp_peptide_hit = PeptideHit()  
        temp_pe.setProteinAccession(fe.identifier);
 
        temp_peptide_hit.setPeptideEvidences([temp_pe])  
  
        # digestion
 
        current_digest = []  
        aaseq = AASequence()  
        if (options.enzyme == "none"):
 
            current_digest.append(aaseq.fromString(fe.sequence))  
        else:
 
            dropped_by_length += digestor.digest(aaseq.fromString(fe.sequence), current_digest, options.min_length, options.max_length)
 
  
        for seq in current_digest:  
            # fill the PeptideHit and PeptideIdentification datastructure
 
            peptide_identification = PeptideIdentification()  
            temp_peptide_hit.setSequence(seq)
 
            peptide_identification.insertHit(temp_peptide_hit)
 
            peptide_identifications.append(peptide_identification)  

 
    print(str(dropped_by_length) + " peptides have been dropped due to the length restriction.")
 
    idxml = IdXMLFile() 
    idxml.store(options.outfile, protein_identifications, peptide_identifications)
9.5.3 Putting things together

The paramter input and the functions can be used to construct the program we are looking for. If you are struggling please have a look in the example data section ProteinDigestor.py

Now you can run your tool in the Anaconda Terminal ( Example _Data  pyopenms
):

python ProteinDigestor.py -in mini_example.fasta -out mini_example_out.idXML -enzyme Trypsin -min_length 6 -max_length 40 -missed_cleavages 1
9.5.4 Bonus task

Task

Implement all other 184 TOPP tools using pyOpenMS.

10 Quality control

10.1 Introduction

In this chapter, we will build on an existing workflow with OpenMS / KNIME to add some quality control (QC). We will utilize the qcML tools in OpenMS to create a file with which we can collect different measures of quality to the mass spectrometry runs themselves and the applied analysis. The file also serves the means of visually reporting on the collected quality measures and later storage along the other analysis result files. We will, step-by-step, extend the label-free quantitation workflow from section 3 with QC functions and thereby enrich each time the report given by the qcML file. But first, to make sure you get the most of this tutorial section, a little primer on how we handle QC on the technical level.

QC metrics and qcML

To assert the quality of a measurement or analysis we use quality metrics. Metrics are describing a certain aspect of the measurement or analysis and can be anything from a single value, over a range of values to an image plot or other summary. Thus, qcML metric representation is divided into QC parameters (QP) and QC attachments (QA) to be able to represent all sorts of metrics on a technical level.
A QP may (or may not) have a value which would equal a metric describable with a single value. If the metric is more complex and needs more than just a single value, the QP does not require the single value but rather depends on an attachment of values (QA) for full meaning. Such a QA holds the plot or the range of values in a table-like form. Like this, we can describe any metric by a QP and an optional QA.
To assure a consensual meaning of the quality parameters and attachments, we created a controlled vocabulary (CV). Each entry in the CV describes a metric or part/extension thereof. We embed each parameter or attachment with one of these and by doing so, connect a meaning to the QP/QA. Like this, we later know exactly what we collected and the programs can find and connect the right dots for rendering the report or calculating new metrics automatically. You can find the constantly growing controlled vocabulary here:
https://github.com/qcML/qcML  -development/blob/master/cv/qc-cv.obo
.
Finally, in a qcml file, we split the metrics on a per mass-spectrometry-run base or a set of mass-spectrometry-runs respectively. Each run or set will contain its QP/QA we calculate for it, describing their quality.

10.2 Building a qcML file per run

As a start, we will build a basic qcML file for each mzML file in the label-free analysis. We are already creating the two necessary analysis files to build a basic qcML file upon each mzML file, a feature file and an identification file. We use the QCCalculator node from Community NodeOspenMS   Utilities  where also all other QC* nodes will be found. The QCCalculator will create a very basic qcML file in which it will store collected and calculated quality data.

The created qcML files will not have much to show for, basic as they are. So we will extend them with some basic plots.

There are two other basic plots which we almost always might want to look at before judging the quality of a mass spectrometry run and its identifications: the total ion current (TIC) and the PSM mass error (Mass accuracy), which we have available as pre-packaged QC metanodes.

Task

Import the workflow from Workflows   Quality   Control  QC  Metanodes.zip in KNIME: File           Import KNIME Workflow...

R Dependencies: This section requires that the R packages ggplot2 and scales are both installed. This is the same procedure as in section 6.4.5. In case that you use an R installation where one or both of them are not yet installed, open the R Snippet nodes inside the metanodes you just used (double-click). Edit the script in the R Script text editor from:

 #install.packages("ggplot2")  
#install.packages("scales")

to

 install.packages("ggplot2")  
install.packages("scales")

Press Eval script  to execute the script.

PIC

Figure 47: Basic QC setup within a LFQ workflow

Note: To have a peek into what our qcML now looks like for one of the ZipLoop iterations, we can add an Output Folder node from Community Nodes  GenericKnimeNIoOdes  and set its destination parameter to somewhere we want to find our intermediate qcML files in, for example tmp   qc_lfq  . If we now connect the last metanode with the Output Folder and restart the workflow, we can start inspecting the qcML files.

Task

Find your first created qcML file and open it with the browser (not IE), and the contained QC parameters will be rendered for you.

10.3 Adding brand new QC metrics

We can also add brand new QC metrics to our qcML files. Remember the Histogram you added inside the ZipLoop during the label-free quantitation section? Let’s imagine for a moment this was a brand new and utterly important metric and plot for the assessment of your analyses quality. There is an easy way to integrate such new metrics into your qcMLs. Though the Histogram node cannot pass its plot to an image, we can do so with a R View (table).

 #install.packages("ggplot2")   
library("ggplot2")  
ggplot(knime.in, aes(x=peptide_charge)) +
 
 geom_histogram(binwidth=1, origin =-0.5) +  
 scale_x_discrete() +
 
 ggtitle("Identified peptides charge histogram") + 
 ylab("Count")

PIC

Figure 48: QC with new metric

10.4 Set QC metrics

Besides monitoring the quality of each individual mass spectrometry run analysis, another capability of QC with OpenMS and qcML is to monitor the complete set. The easiest control is to compare mass spectrometry runs which should be similar, e.g. technical replicates, to spot any aberrations in the set.
For this, we will first collect all created qcML files, merge them together and use the qcML onboard set QC properties to detect any outliers.

When inspecting the set-qcML file in a browser, we will be presented another overview. After the set content listing, the basic QC parameters (like number of identifications) are each displayed in a graph. Each set member (or run) has its own section on the x-axis and each run is connected with that graph via a link in the mouseover on one of the QC parameter values.

PIC

Figure 49: QC set creation from ZipLoop

Task

For ideas on new QC metrics and parameters -as you add them in your qcML files as generic parameters, feel free to contact us, so we can include them in the CV.

11 Troubleshooting guide

This section will show you where you can turn to when you encounter any problems with this tutorial or with our nodes in general. Please see the FAQ first. If your problem is not listed or the proposed solution does not work, feel free to leave us a message at the means of support that you see most fit. If that is the case, please provide us with as much information as you can. In an ideal case, that would be:

11.1 FAQ

11.1.1 How to debug KNIME and/or the OpenMS nodes?

11.1.2 General

Q: Can I add my own modifications to the Unimod.xml?
A: Unfortunately not very easy. This is an open issue since the selections are hard-coded during creation of the tools. We included 10 places for dummy modifications that can be entered in our Unimod.xml and selected in KNIME.

Q: I have problem XYZ but it also occurs with other nodes or generally in the KNIME environment/GUI, what should I do?
A: This sounds like a general KNIME bug and we advise to search help directly at the KNIME developers. They also provide a FAQ and a forum.

Q: After exporting and reading in results into a KNIME table (e.g. with a MzTabExporter and MzTabReader combination) numeric values get rounded (e.g. from scientific notation 4.5e-10 to zero) or are in a different representation than in the underlying exported file!
A: Please try a different table column renderer in KNIME. Open the table in question, right-click on the header of an affected column and select another Available Renderer by hovering and finally left-clicking.

Q: I have checked all the configurations but KNIME complains that it can not find certain output Files (FileStoreObjects).
A: Sometimes KNIME/GKN has hiccups with multiple nodes with a same name, executed at the same time in the same loop. We have seen that a simple save and restart of KNIME usually solves the problem.

11.1.3 Platform-specific problems

Linux
Q: Whenever I try to execute an OpenMS node I get an error similar to these:

/usr/lib/x86_64-linux-gnu/libgomp.so.1: version `GOMP_4.0' not found
/usr/lib/x86_64-linux-gnu/libstdc++.so.6: version `GLIBCXX_3.4.20' not found

A: We currently build the binaries shipped in the OpenMS KNIME plugin with gcc 4.8. We will try to extend our support for older compilers. Until then you either need to upgrade your gcc compiler or at least the library that the tool complained about or you need to build the binaries yourself (see OpenMS documentation) and replace them in your KNIME binary folder
(YOURKNIMEFOLDER/plugins/de.openms.platform.architecture.version/payload/bin).

Q: Why is my configuration dialog closing right away when I double-click or try to configure it? Or why is my GUI responding so slow?
A: If you have any problems with the KNIME GUI or the opening of dialogues under Linux you might be affected by a GTK bug. See the KNIME forum (e.g. here or here) for a discussion and a possible solution. In short: set environment variable by calling export SWT_GTK3=0 or edit knime.ini to make Eclipse use GTK2 by adding the following two lines:
–launcher.GTK_version
2

macOS
Q: I have problems installing RServe in my local R installation for the R KNIME Extension:
A: If you encounter linker errors while running install.packages(”Rserve”) when using an R installation from homebrew, make sure gettext is installed via homebrew and you pass flags to its lib directory. See StackOverflow question 21370363.

Q: Although I Ctrl
+Leftclick  TOPPAS.app or TOPPView.app and accept the risk of a downloaded application, the icon only shortly blinks and nothing happens:
A: It seems like your OS is not able to remove the quarantine flag. If you trust us, please remove it yourself by typing the following command in your Terminal.app:
xattr- r -d com.apple.quarantine /Applications/OpenMS -2.3.0

Windows
Q: KNIME has problems getting the requirements for some of the OpenMS nodes on Windows, what can I do?
A: Get the prerequisites installer here or install .NET3.5, .NET4 and VCRedist10.0 and 12.0 yourself.

11.1.4 Nodes

Q: Why is my XTandemAdapter printing empty or VERY few results, although I did not use an e-value cutoff?
A: Due to a bug in OpenMS 2.0.1 the XTandemAdapter requires a default parameter file. Give it the default configuration in
YOURKNIMEFOLDER/plugins/de.openms.platform.architecture.version/payload/share/
CHEMISTRY/XTandem  _default_input.xml  as a third input file. This should be resolved in newer versions though, such that it automatically uses this file if the optional inputs is empty. This should be solved in newer versions.

Q: Do MSGFPlusAdapter, LuciphorAdapter or SiriusAdapter generally behave different/unexpected?
A: These are Java processes that are started underneath. For example they can not be killed during cancellation of the node. This should not affect its performance, however. Make sure you set the Java memory parameter in these nodes to a reasonable value. Also MSGFPlus is creating several auxiliary files and accesses them during execution. Some users therefore experienced problems when executing several instances at the same time.

11.2 Sources of support

If your questions could not be answered by the FAQ, please feel free to turn to our developers via one of the following means:

References

[1]   OpenMS, OpenMS home page [online].

[2]   M. Sturm, A. Bertsch, C. Gröpl, A. Hildebrandt, R. Hussong, E. Lange, N. Pfeifer, O. Schulz-Trieglaff, A. Zerck, K. Reinert, and O. Kohlbacher, OpenMS - an open-source software framework for mass spectrometry., BMC bioinformatics 9(1) (2008), doi:10.1186/1471-2105-9-163.

[3]   H. L. Röst, T. Sachsenberg, S. Aiche, C. Bielow, H. Weisser, F. Aicheler, S. Andreotti, H.-C. Ehrlich, P. Gutenbrunner, E. Kenar, et al., OpenMS: a flexible open-source software platform for mass spectrometry data analysis, Nature Methods 13(9), 741–748 (2016).

[4]   O. Kohlbacher, K. Reinert, C. Gröpl, E. Lange, N. Pfeifer, O. Schulz-Trieglaff, and M. Sturm, TOPP–the OpenMS proteomics pipeline., Bioinformatics 23(2) (Jan. 2007).

[5]   M. R. Berthold, N. Cebron, F. Dill, T. R. Gabriel, T. Kötter, T. Meinl, P. Ohl, C. Sieb, K. Thiel, and B. Wiswedel, KNIME: The Konstanz Information Miner, in Studies in Classification, Data Analysis, and Knowledge Organization (GfKL 2007), Springer, 2007.

[6]   M. Sturm and O. Kohlbacher, TOPPView: An Open-Source Viewer for Mass Spectrometry Data, Journal of proteome research 8(7), 3760–3763 (July 2009), doi:10.1021/pr900171m.

[7]   RDKit: Open-source cheminformatics, http://www.rdkit.org, [Online; accessed 31-August-2018].

[8]    C. Steinbeck, Y. Han, S. Kuhn, O. Horlacher, E. Luttmann, and E. Willighagen, The Chemistry Development Kit (CDK):  An Open-Source Java Library for Chemo- and Bioinformatics, Journal of Chemical Information and Computer Sciences 43(2), 493–500 (2003), PMID: 12653513, doi:10.1021/ci025584y.

[9]   L. Y. Geer, S. P. Markey, J. A. Kowalak, L. Wagner, M. Xu, D. M. Maynard, X. Yang, W. Shi, and S. H. Bryant, Open mass spectrometry search algorithm, Journal of Proteome Research 3(5), 958–964 (2004).

[10]   A. Chawade, M. Sandin, J. Teleman, J. Malmström, and F. Levander, Data Processing Has Major Impact on the Outcome of Quantitative Label-Free LC-MS Analysis, Journal of Proteome Research 14(2), 676–687 (2015), PMID: 25407311, arXiv:http://dx.doi.org/10.1021/pr500665j, doi:10.1021/pr500665j.

[11]   M. Choi, C.-Y. Chang, T. Clough, D. Broudy, T. Killeen, B. MacLean, and O. Vitek, MSstats: an R package for statistical analysis of quantitative mass spectrometry-based proteomic experiments, Bioinformatics 30(17), 2524–2526 (2014), doi:10.1093/bioinformatics/btu305.

[12]   M. Choi, Z. F. Eren-Dogu, C. Colangelo, J. Cottrell, M. R. Hoopmann, E. A. Kapp, S. Kim, H. Lam, T. A. Neubert, M. Palmblad, B. S. Phinney, S. T. Weintraub, B. MacLean, and O. Vitek, ABRF Proteome Informatics Research Group (iPRG) 2015 Study: Detection of Differentially Abundant Proteins in Label-Free Quantitative LC-MS/MS Experiments, J. Proteome Res. 16(2), 945–957 (2017), doi:10.1021/acs.jproteome.6b00881.

[13]   T. Huang, M. Choi, S. Hao, and O. Vitek, MSstatsTMT: Protein Significance Analysis in shotgun mass spectrometry-based proteomic experiments with tandem mass tag (TMT) labeling., (2020), doi:10.18129/B9.bioc.MSstatsTMT.

[14]   D. S. Wishart, D. Tzur, C. Knox, et al., HMDB: the Human Metabolome Database, Nucleic Acids Res 35(Database issue), D521–6 (Jan 2007), doi: 10.1093/nar/gkl923.

[15]   D. S. Wishart, C. Knox, A. C. Guo, et al., HMDB: a knowledgebase for the human metabolome, Nucleic Acids Res 37(Database issue), D603–10 (Jan 2009), doi:10.1093/nar/gkn810.

[16]   D. S. Wishart, T. Jewison, A. C. Guo, M. Wilson, C. Knox, et al., HMDB 3.0–The Human Metabolome Database in 2013, Nucleic Acids Res 41(Database issue), D801–7 (Jan 2013), doi:10.1093/nar/gks1065.

[17]   J. Griss, A. R. Jones, T. Sachsenberg, M. Walzer, L. Gatto, J. Hartler, G. G. Thallinger, R. M. Salek, C. Steinbeck, N. Neuhauser, J. Cox, S. Neumann, J. Fan, F. Reisinger, Q.-W. Xu, N. Del Toro, Y. Perez-Riverol, F. Ghali, N. Bandeira, I. Xenarios, O. Kohlbacher, J. A. Vizcaino, and H. Hermjakob, The mzTab Data Exchange Format: communicating MS-based proteomics and metabolomics experimental results to a wider audience, Mol Cell Proteomics (Jun 2014), doi: 10.1074/mcp.O113.036681.

[18]   S. Böcker, M. C. Letzel, Z. Lipták, and A. Pervukhin, SIRIUS: Decomposing isotope patterns for metabolite identification, Bioinformatics 25(2), 218–224 (2009), doi:10.1093/bioinformatics/btn603.

[19]   S. Böcker and K. Dührkop, Fragmentation trees reloaded, J. Cheminform. 8(1), 1–26 (2016), doi:10.1186/s13321-016-0116-8.

[20]   K. Dührkop, H. Shen, M. Meusel, J. Rousu, and S. Böcker, Searching molecular structure databases with tandem mass spectra using CSI:FingerID, Proc. Natl. Acad. Sci. 112(41), 12580–12585 (oct 2015), doi:10.1073/pnas.1509788112.

[21]   H. L. Röst, G. Rosenberger, P. Navarro, L. Gillet, S. M. Miladinovic, O. T. Schubert, W. Wolski, B. C. Collins, J. Malmstrom, L. Malmström, and R. Aebersold, OpenSWATH enables automated, targeted analysis of data-independent acquisition MS data, Nature Biotechnology 32(3), 219–223 (Mar. 2014).

[22]   L. C. Gillet, P. Navarro, S. Tate, H. Röst, N. Selevsek, L. Reiter, R. Bonner, and R. Aebersold, Targeted Data Extraction of the MS/MS Spectra Generated by Data-independent Acquisition: A New Concept for Consistent and Accurate Proteome Analysis., Molecular & Cellular Proteomics 11(6) (June 2012), doi: 10.1074/mcp.O111.016717.

[23]   A. Bertsch, C. Gröpl, K. Reinert, and O. Kohlbacher, OpenMS and TOPP: open source software for LC-MS data analysis., Methods in molecular biology (Clifton, N.J.) 696, 353–367 (2011), doi:10.1007/978-1-60761-987-1_23.

[24]   H. L. Röst, T. Sachsenberg, S. Aiche, C. Bielow, H. Weisser, F. Aicheler, S. Andreotti, H.-c. Ehrlich, P. Gutenbrunner, E. Kenar, X. Liang, S. Nahnsen, L. Nilse, J. Pfeuffer, G. Rosenberger, M. Rurik, U. Schmitt, J. Veit, M. Walzer, D. Wojnar, W. E. Wolski, O. Schilling, J. S. Choudhary, L. Malmström, R. Aebersold, K. Reinert, and O. Kohlbacher, OpenMS: a flexible open-source software platform for mass spectrometry data analysis, Nat. Methods 13(9), 741–748 (sep 2016), doi:10.1038/nmeth.3959.

[25]   J. Pfeuffer, T. Sachsenberg, O. Alka, M. Walzer, A. Fillbrunn, L. Nilse, O. Schilling, K. Reinert, and O. Kohlbacher, OpenMS - A platform for reproducible analysis of mass spectrometry data, J. Biotechnol. 261(February), 142–148 (2017), doi:10.1016/j.jbiotec.2017.05.016.

[26]   L. Reiter, O. Rinner, P. Picotti, R. Huttenhain, M. Beck, M.-Y. Brusniak, M. O. Hengartner, and R. Aebersold, mProphet: automated data processing and statistical validation for large-scale SRM experiments, Nature Methods 8(5), 430–435 (May 2011), doi:10.1038/nmeth.1584.

[27]   E. W. Deutsch, M. Chambers, S. Neumann, F. Levander, P.-A. Binz, J. Shofstahl, D. S. Campbell, L. Mendoza, D. Ovelleiro, K. Helsens, L. Martens, R. Aebersold, R. L. Moritz, and M.-Y. Brusniak, TraML—A Standard Format for Exchange of Selected Reaction Monitoring Transition Lists, Molecular & Cellular Proteomics 11(4) (Apr. 2012), doi:10.1074/mcp.R111.015040.

[28]   C. Escher, L. Reiter, B. MacLean, R. Ossola, F. Herzog, J. Chilton, M. J. MacCoss, and O. Rinner, Using iRT, a normalized retention time for more targeted measurement of peptides., Proteomics 12(8), 1111–1121 (Apr. 2012), doi:10.1002/ pmic.201100463.

[29]   H. L. Röst, G. Rosenberger, P. Navarro, L. Gillet, S. M. Miladinović, O. T. Schubert, W. Wolski, B. C. Collins, J. Malmström, L. Malmström, and R. Aebersold, OpenSWATH enables automated, targeted analysis of data-independent acquisition MS data., Nat. Biotechnol. 32(3), 219–23 (2014), doi:10.1038/nbt.2841.

[30]   J. Teleman, H. L. Röst, G. Rosenberger, U. Schmitt, L. Malmström, J. Malmström, and F. Levander, DIANA-algorithmic improvements for analysis of data-independent acquisition MS data, Bioinformatics 31(4), 555–562 (2015), arXiv:9808008, doi:10.1093/bioinformatics/btu686.

[31]   K. Dührkop, M. Fleischauer, M. Ludwig, A. A. Aksenov, A. V. Melnik, M. Meusel, P. C. Dorrestein, J. Rousu, and S. Böcker, SIRIUS 4: a rapid tool for turning tandem mass spectra into metabolite structure information, Nat. Methods 16(4), 299–302 (apr 2019), doi:10.1038/s41592-019-0344-8.

[32]   J. E. Elias and S. P. Gygi, Target-decoy search strategy for increased confidence in large-scale protein identifications by mass spectrometry, Nat. Methods 4(3), 207–214 (Mar. 2007).

[33]   K. Scheubert, F. Hufsky, D. Petras, M. Wang, L. F. Nothias, K. Dührkop, N. Bandeira, P. C. Dorrestein, and S. Böcker, Significance estimation for large scale metabolomics annotations by spectral matching, Nat. Commun. 8(1) (2017), doi:10.1038/s41467-017-01318-5.